Property Summary

NCBI Gene PubMed Count 144
PubMed Score 741.27
PubTator Score 154.64

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
psoriasis -1.300 3.1e-04
posterior fossa group B ependymoma -1.600 2.4e-09
group 4 medulloblastoma 2.200 2.9e-04
glioblastoma 1.400 8.7e-04
medulloblastoma, large-cell 2.200 1.4e-05
Atopic dermatitis 1.300 1.1e-03
adrenocortical carcinoma 1.474 5.5e-03
non-small cell lung cancer 2.178 6.0e-18
lung cancer 1.800 5.6e-05
colon cancer 1.700 2.8e-05
pancreatic cancer 1.600 2.4e-05
interstitial cystitis 1.100 2.7e-04
pediatric high grade glioma 1.500 3.6e-04
ulcerative colitis 1.400 1.8e-03
ovarian cancer 1.300 1.1e-03
chronic rhinosinusitis 1.033 1.6e-02
cystic fibrosis and chronic rhinosinusit... 1.114 2.2e-02

Gene RIF (110)

PMID Text
26945069 elevated L-plastin expression promotes elongation and reduces protrusion density in cells with relatively lower L-plastin than fascin levels.
26749573 TGF-beta1 could induce the expressions of Fascin1 mRNA and protein and thus improve the invasive and metastatic ability of human renal carcinoma cells.
26647829 The present study revealed an antioncogenic role of miR145 in gastric carcinoma via inhibition of FSCN1, and suggested that miR145 may be used for the treatment of gastric carcinoma.
26522130 Study demonstrates that FSCN1 is associated with increased risk of recurrence in pituitary adenomas and invasion, partially through modifying the expression of Notch/DLL pathway.
26503504 MiR-24 functions as a tumor suppressor in nasopharyngeal carcinoma through targeting FSCN1
26362828 Strong fascin-1 expression was found in 14.3% of borderline epithelial tumors of the ovary and linked to features related to elevated risk of recurrence.
26349603 Fascin-1 and paxillin were expressed in 58% and 43% of infiltrating duct carcinoma cases. There was a significant correlation between fascin-1 and paxillin expression and tumor grade, clinical stage, lymph-node metastasis grade, and HER2 expression.
26238532 miR-145 negatively regulates the protein expression of its target FSCN1 in the NSCLC cell line H129.
26211585 FSCN1 plays an important role in non-small cell lung cancer progression and prognosis.
26173501 The up-regulation of FSCN1 is a prognostic factor in patients diagnosed with hepatocellular liver cancer.
26010149 miR-145 regulates cell migration and invasion in gastric cancer primarily by directly targeting FSCN1.
25831081 regulates translation through miR-155 and miR-125b, which target 3' UTR in TNF-alpha mRNA
25815687 the anti-oncogenic activity of miR-133a may involve the inhibition of the target gene FSCN1. The present study suggested that miR-133a may be a potential therapeutic target in the treatment of gastric cancer.
25808493 Alterations in nuclear Fascin levels result in defects in nucleolar morphology in both Drosophila follicles and cultured mammalian cells, suggesting that nuclear Fascin plays an important role in nucleolar architecture.
25601713 The cortactin SH3 domain contributes to podosome assembly while fascin actin bundling is a master regulator of podosome disassembly in THP-1 macrophages and dendritic cells.
25535872 Upregulated fascin expression was detected in melanoma metastases, but was not correlated to patient outcome.
25433493 miR-133b directly targeted FSCN1 which functioned as an oncogenic gene in gastric cancer cells.
25213863 In addition to IL-6, TNF-alpha increases Stat3 and NFkappaB binding to the fascin promoter to induce its expression.
25198665 miR-133a functions as a tumor suppressor and directly targets FSCN1 in pancreatic cancer.
25155376 In ovarian primary mucinous tumors, fascin and EMMPRIN may play an important role in tumor progression from benign tumor to carcinoma.
25105941 LMP1-mediated upregulation of Fascin depends on NF-kappaB and both NF-kappaB and Fascin contribute to invasive migration of LMP1-expressing lymphocytes.
24977742 Fascin is overexpressed in most cervical intraepithelial neoplasia lesions and this may be a marker of increased invasive potential in high grade cervical intraepithelial neoplasia
24930964 Fascin plays a role in stress fiber organization and focal adhesion disassembly.
24642628 MiR-145 has a critical role in the inhibition of invasive and metastatic capacities of colorectal cancer (CRC), probably through directly targeting Fascin-1. This miRNA may be involved in the development and progression of CRC.
24599125 Fascin is a direct target gene of HIF-1a.
24378809 We found that fascin1 expression is a potential poor marker of prognosis for patients with High-grade serous ovarian carcinoma
24235142 GATA3 transcription factor abrogates Smad4 transcription factor-mediated fascin overexpression, invadopodium formation, and breast cancer cell invasion.
24196787 The combined expression of FSCN1 and MMP14 is associated with a poor prognosis, and miR-133a, which regulates their mRNAs, can serve as a strong tumour suppressor of ESCC.
24085294 protein effectors of the RSK2-CREB-Fascin-1 pathway represent promising biomarkers and therapeutic targets in the clinical prognosis and treatment of metastatic human cancers.
23986556 results suggest that fascin is a marker for triple negative breast cancer subtype having a basal-like phenotype
23899558 over-expressed microRNA-451 in colon cancer cells might inhibit AMPK to activate mTORC1, which mediates FSCN1 expression and cancer cell progression.
23898208 HIV-1 Vif upregulates the expression of fascin homolog 1, actin-bundling protein (FSCN1) in Vif-expression T cells
23633513 fascin 1 promotes cell migration and has a role in growth and cell cycle progression
23454725 GLI3, fascin and TUBB3 are the most sensitive markers in Hodgkin lymphoma and anaplastic large cell lymphoma.
23428845 fascin may have a role in urothelial carcinoma migration and invasion
23393326 FSCN1 is frequently expressed in primary epithelial ovarian cancer
23333304 HIV-1 Vif upregulates the expression of fascin homolog 1, actin-bundling protein (FSCN1) in Vif-expression T cells
23252866 fascin expression was related to worse survival rates and can be an independent poor prognostic factor in gastric cancer.
23221510 The data showed that both fascin and vimentin proteins were significantly overexpressed in cholangiocarcinoma, whereas E-cadherin expression was reduced in cholangiocarcinoma compared with normal tissues.
23209815 Fascin-1, ezrin and paxillin contribute to the malignant progression and are predictors of clinical prognosis in laryngeal squamous cell carcinoma.
23196799 Our results suggest that downregulation of miR-133b and overexpression of fascin-1 may have an important role in the progression of gastrointestinal stromal tumor
23184945 analysis of the molecular mechanism of fascin function in filopodial formation
23156804 The high expression of Fascin and angiogenesis are significantly associated with biological behaviour of sinonasal inverted papilloma.
23030700 overexpression of cortactin and fascin-1 implies poorer tumor differentiation, advanced AJCC stage, and shorter survival rate in pancreatic and ampulla of Vater adenocarcinomas
22883572 A novel activity of Rho in promoting a complex between fascin-1 and LIMK1/2 that modulates the interaction of fascin-1 with actin, was identified.
22784357 fascin might be an independent prognostic indicator in the different steps of extracellular matrix invasion in endometrioid carcinomas
22730814 The abnormal expression of FSCN1 and HGF in the inferior turbinate may be closely correlated with nasal inverted papilloma and its malignant process.
22128198 Novel fascin expression occurs during the development and progression of some endocervical neoplasms and may have a role in areas of active tumor invasion.
22110277 Data suggest that fascin promotes pancreatic cancer cell migration, invasion and scattering, thus contributes to the aggressive behavior of pancreatic cancer cells.
22076152 High Fascin is associated with breast cancer invasion and metastasis.
22005766 Fascin may regulate functions of human hepatic stellate cells (HSCs) through the FAK-phosphoinositide 3-kinase-Akt pathway.
21975550 The role of actin bundling proteins in the assembly of filopodia in epithelial cells
21937440 Both STAT3 and NFkappaB are required for the cytokine-induced expression of fascin in cancer cells.
21914811 fascin expression significantly correlates with TGFbeta1 and TGFbeta receptor I levels in a cohort of primary breast tumor samples.
21771028 There are distinct micro-anatomical variations in fascin immunoreactivity within endometrial carcinoma. Microcystic, elongated and fragmented-type alteration may represent areas of active tumour invasion.
21764699 The abnormal expression of fascin may play an important role in the progression of esophageal squamous cell carcinoma.
21498718 Fascin has a potential role as an early detection biomarker and CK4 as a tumor marker in esophageal squamous cell carcinoma.
21491467 Fascin promotes the epithelial-mesenchymal transition of breast cancer cells, and overexpression may be correlated with tumor aggressiveness.
21390241 The prognostic impact of TGF-beta1, NF-kappaB p105, PKC-zeta, Par-6alpha, E-cadherin and vimentin in non-gastrointestinal stromal tumor soft tissue sarcomas, was investigated.
21323792 propose that fascin-1 primarily acts as a migration factor associated with epithelial-mesenchymal transition in hepatocellular carcinoma cells and facilitates their invasiveness in combination with matrix metalloproteinases
21300980 Fascin up-regulation by Tax contributes to the development of HTLV-1-associated pathogenesis.
21258769 miR-145 expression suppresses cell proliferation, migration and invasion in prostate cancer by targeting FSCN1
21223690 Fascin and CK14 are highly expressed in squamous cell carcinoma, compared with other histological types of carcinoma.
21089665 Inhibition of Fascin-1 expression in Hep-2 cells could break the integrity of cytoskeleton and decrease the ability of cellular immigration.
20888270 Data indicate that fascin expression was up-regulated in bladder urothelial carcinoma.
20819441 Fascin mRNA levels were significantly reduced at all three breast cancer stages (T0 - T1, T2 and T3) compared with control tissue.
20713986 high expression of fascin correlates with poor outcome and that high expression of phospho-S39-fascin decreases the risk of poor prognosis in esophageal squamous cell carcinoma
20701077 HSP47 and fascin expression may play role in the pathogenesis of invasive ductal carcinoma of the breast and prostatic adenocarcinoma because their expression is significantly higher than their normal counterpart.
20634891 Observational study of gene-disease association. (HuGE Navigator)
20596974 Over expression of fascin in high-grade dysplastic epithelium in Sinonasal inverted papilloma may be associated with tumor progression and malignant transformation
20434460 The structure reveals a novel arrangement of four tandem beta-trefoil domains that form a bi-lobed structure with approximate pseudo 2-fold symmetry.
20366178 The mechanism of bundling of cytoskeletal actin filaments by two representative bundling proteins, fascin and espin, was examined.
20137952 The actin-bundling protein fascin stabilizes actin in invadopodia and potentiates protrusive invasion.
20056838 Fascin regulates the proliferation and invasiveness of ESCC cells by modulating the expression of CTGF and CYR61 via TGF-beta pathway.
20001345 Down-regulation of fascin1 suppresses the proliferation and migration of gastric cancer cells MKN45.
19819618 fascin1 plays a significant role in non-small cell lung cancer metastasis
19818782 Galectin-3 increases gastric cancer cell motility by up-regulating fascin-1 expression.
19759191 High expression level of fascin1 was associated with nasopharyngeal carcinoma aggressiveness.
19741544 Simultaneous analyses of fascin-1 and E-cadherin expression could be more effective in evaluating the prognoses of patients with laryngeal squamous cell carcinoma.
19738613 fascin is overexpressed in colorectal adenomas and promotes motility in adenoma cells in vitro.
19729655 study found that Rab35 regulates the assembly of actin filaments in filopodia formation; effect was mediated by the actin-bundling protein fascin, which directly associated with active Rab35
19721413 Overexpression of fascin may have an important function in the progression of cholangiocarcinoma.
19657566 Study found that ERK and JNK pathways are involved in TGF-b1-induced fascin1 expression in the human gastric cancer cell line MKN45.
19556073 High fascin expression is significantly correlated with aggressive tumor phenotype in extrahepatic bile duct carcinoma and is an independent poor prognostic factor in extrahepatic bile duct carcinoma.
19483633 Fascin can serve as a reliable immunohistochemical marker in distinguishing uterine leiomyosarcoma from leiomyoma variants and usual leiomyoma
19340314 data identify novel roles for CREB and AhR as major, specific regulators of FSCN-1 transcription in human carcinoma cells but do not support the hypothesis that beta-catenin signaling has a central role
19133007 Cadherin-11 and fascin might be useful markers for recurrence of pleomorphic adenomas.
19115695 Intense and strong fascin staining is found granulosa cell tumor adult type (AGCT);of fascin should question a provisional morphologic diagnosis of AGCT.
19061289 Fascin overexpression may be a marker of aggressive urothelial carcinomas.
18851787 Expression of EBV LMP1 is positively correlated with Fascin, pStat3 and the proliferation index of tumor cells in nasopharyngeal carcinoma.
18776588 Cortactin, fascin-1 and EGFR have roles in progression of ovarian carcinomas
18716283 Rac regulates the interaction of fascin with active PKC.
18599451 Myosin X filopodial localization is perturbed in fascin-depleted HeLa cells, demonstrating that fascin bundles also direct motility in vivo.
18587253 The fascin-1 expression did not correlate with the depth of tumor invasion or with the urinary bladder tumor recurrence or progression.
18343949 Fascin may be a novel marker to distinguish thyroid carcinoma from benign lesions
18283337 This study demonstrates a role for fascin in glioma cell morphology, motility, and invasiveness.
17671164 Analysis of fascin bundling indicated that filopodia are semiordered bundles with one bound fascin per 25-60 actin monomers.
17638895 Fascin is a novel target of beta-catenin-TCF signaling and is expressed at the invasive front of human colon cancer
17510372 Higher intensity of cortactin and fascin-1 staining correlated directly with more-advanced cancer stages (TNM) and inversely with survival rates.
17473384 Higher expression of fascin-1 correlates significantly with tumor grades and stages in colorectal adenocarcinomas.
17255360 LXR is a potent modulator of dendritic cells maturation and function mediated in part by blocking the expression of fascin.
17029629 Fascin is upregulated in a proportion of adenomas, where its expression is often focal. Fascin may have prognostic value as an early biomarker for more aggressive colorectal adenocarcinomas.
16977579 Higher fascin scores in fascin in renal cell carcinoma were significantly correlated with higher T and N stages and nuclear grade
16533778 Over expression of fascin is associated with basal-like phenotype and BRCA1-associated node-negative invasive breast carcinomas
15882811 In conclusion, this research supports FSCN1 as a novel marker of NT2 neuronal differentiation and the possible role of CBP in its regulation.
15671545 fascin is an actin-bundling motility protein with a role in progression of hormone receptor-negative breast cancer
14535950 Fascin-1 plays an essential role in polarity of actin bundles in filopodia. In the in vitro motility assay, actin/fascin bundles slid as fast as single actin filaments on myosin II and myosin V
12902483 Fascin regulatory sequences are found solely in the 5'-flanking promoter region; the promoter exerts robust activity in dendritic cells (DC) and a fascin-positive neuronal cell line; promoter activity in DC markedly increases with maturation of DC.
12592367 Fascin is upregulated in invasive and more aggressive NSCLC, being an independent prognostic predictor of unfavourable clinical course of the disease
12100631 fascin is expressed in cutaneous CD30+ lymphoproliferative disorders and that it is a candidate marker of disease progression

AA Sequence

MTANGTAEAVQIQFGLINCGNKYLTAEAFGFKVNASASSLKKKQIWTLEQPPDEAGSAAVCLRSHLGRYL      1 - 70
AADKDGNVTCEREVPGPDCRFLIVAHDDGRWSLQSEAHRRYFGGTEDRLSCFAQTVSPAEKWSVHIAMHP     71 - 140
QVNIYSVTRKRYAHLSARPADEIAVDRDVPWGVDSLITLAFQDQRYSVQTADHRFLRHDGRLVARPEPAT    141 - 210
GYTLEFRSGKVAFRDCEGRYLAPSGPSGTLKAGKATKVGKDELFALEQSCAQVVLQAANERNVSTRQGMD    211 - 280
LSANQDEETDQETFQLEIDRDTKKCAFRTHTGKYWTLTATGGVQSTASSKNASCYFDIEWRDRRITLRAS    281 - 350
NGKFVTSKKNGQLAASVETAGDSELFLMKLINRPIIVFRGEHGFIGCRKVTGTLDANRSSYDVFQLEFND    351 - 420
GAYNIKDSTGKYWTVGSDSAVTSSGDTPVDFFFEFCDYNKVAIKVGGRYLKGDHAGVLKASAETVDPASL    421 - 490
WEY                                                                       491 - 493
//

Text Mined References (153)

PMID Year Title
26945069 2016 Fascin Rigidity and L-plastin Flexibility Cooperate in Cancer Cell Invadopodia and Filopodia.
26749573 2016 TGF-?1-induced Fascin1 promotes cell invasion and metastasis of human 786-0 renal carcinoma cells.
26647829 2016 MicroRNA?145 inhibits the malignant phenotypes of gastric carcinoma cells via downregulation of fascin 1 expression.
26522130 2016 The role of FSCN1 in migration and invasion of pituitary adenomas.
26503504 2015 MiR-24 functions as a tumor suppressor in nasopharyngeal carcinoma through targeting FSCN1.
26362828 2016 Fascin-1 expression as stratification marker in borderline epithelial tumours of the ovary.
26349603 2015 Cytoskeletal Focal Adhesion Proteins Fascin-1 and Paxillin Are Predictors of Malignant Progression and Poor Prognosis in Human Breast Cancer.
26238532 2015 MicroRNA-145 inhibits migration and invasion via inhibition of fascin 1 protein expression in non-small-cell lung cancer cells.
26211585 2015 The clinical significance of FSCN1 in non-small cell lung cancer.
26173501 2015 MicroRNA-145 and MicroRNA-133a Inhibited Proliferation, Migration, and Invasion, While Promoted Apoptosis in Hepatocellular Carcinoma Cells Via Targeting FSCN1.
26010149 2015 Reverse Correlation between MicroRNA-145 and FSCN1 Affecting Gastric Cancer Migration and Invasion.
25831081 2015 Fascin regulates TLR4/PKC-mediated translational activation through miR-155 and miR-125b, which targets the 3' untranslated region of TNF-? mRNA.
25815687 2015 MicroRNA-133a inhibits proliferation and invasion, and induces apoptosis in gastric carcinoma cells via targeting fascin actin-bundling protein 1.
25808493 2015 Prostaglandins regulate nuclear localization of Fascin and its function in nucleolar architecture.
25601713 2015 Fascin actin bundling controls podosome turnover and disassembly while cortactin is involved in podosome assembly by its SH3 domain in THP-1 macrophages and dendritic cells.
25535872 2015 Fascin expression is increased in metastatic lesions but does not correlate with progression nor outcome in melanoma.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25433493 2014 The role of microRNA-133b and its target gene FSCN1 in gastric cancer.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25213863 2014 A signal transducer and activator of transcription 3·Nuclear Factor ?B (Stat3·NF?B) complex is necessary for the expression of fascin in metastatic breast cancer cells in response to interleukin (IL)-6 and tumor necrosis factor (TNF)-?.
25198665 2013 miR-133a functions as a tumor suppressor and directly targets FSCN1 in pancreatic cancer.
25155376 2014 Fascin and EMMPRIN expression in primary mucinous tumors of ovary: a tissue microarray study.
25105941 2014 The tumor marker Fascin is induced by the Epstein-Barr virus-encoded oncoprotein LMP1 via NF-?B in lymphocytes and contributes to their invasive migration.
24977742 2014 Fascin expression in cervical normal squamous epithelium, cervical intraepithelial neoplasia, and superficially invasive (stage IA1) squamous carcinoma of the cervix.
24930964 2014 Fascin plays a role in stress fiber organization and focal adhesion disassembly.
24642628 2014 MicroRNA-145 inhibits tumour growth and metastasis in colorectal cancer by targeting fascin-1.
24599125 2014 Hypoxia-inducible factor-1 promotes pancreatic ductal adenocarcinoma invasion and metastasis by activating transcription of the actin-bundling protein fascin.
24378809 2014 Fascin1 expression in high-grade serous ovarian carcinoma is a prognostic marker and knockdown of fascin1 suppresses the proliferation of ovarian cancer cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24235142 2013 GATA3 transcription factor abrogates Smad4 transcription factor-mediated fascin overexpression, invadopodium formation, and breast cancer cell invasion.
24196787 2014 MicroRNA-133a regulates the mRNAs of two invadopodia-related proteins, FSCN1 and MMP14, in esophageal cancer.
24085294 2013 The prometastatic ribosomal S6 kinase 2-cAMP response element-binding protein (RSK2-CREB) signaling pathway up-regulates the actin-binding protein fascin-1 to promote tumor metastasis.
23986556 2014 Strong association of fascin expression with triple negative breast cancer and basal-like phenotype in African-American women.
23899558 2014 MicroRNA-451 regulates AMPK/mTORC1 signaling and fascin1 expression in HT-29 colorectal cancer.
23633513 2013 Fascin 1 is transiently expressed in mouse melanoblasts during development and promotes migration and proliferation.
23454725 2013 Frequent expression of follicular dendritic cell markers in Hodgkin lymphoma and anaplastic large cell lymphoma.
23428845 2013 The role of fascin in migration and invasion of urothelial carcinoma of the bladder.
23393326 2013 Prognostic impact of fascin-1 (FSCN1) in epithelial ovarian cancer.
23252866 2012 Fascin expression is related to poor survival in gastric cancer.
23221510 2013 Differential expression of fascin, E-cadherin and vimentin: Proteins associated with survival of cholangiocarcinoma patients.
23209815 2012 Fascin-1, ezrin and paxillin contribute to the malignant progression and are predictors of clinical prognosis in laryngeal squamous cell carcinoma.
23196799 2013 Fascin-1 overexpression and miR-133b downregulation in the progression of gastrointestinal stromal tumor.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23184945 2013 Molecular mechanism of fascin function in filopodial formation.
23156804 2012 [Expression of fascin and correlation with MVD in sinonasal inverted papilloma].
23030700 2013 The correlation of cortactin and fascin-1 expression with clinicopathological parameters in pancreatic and ampulla of Vater adenocarcinoma.
22883572 2012 A novel Rho-dependent pathway that drives interaction of fascin-1 with p-Lin-11/Isl-1/Mec-3 kinase (LIMK) 1/2 to promote fascin-1/actin binding and filopodia stability.
22784357 2012 Clinicopathological significance of fascin and CD44v6 expression in endometrioid carcinoma.
22730814 2012 [Expression and significances of FSCN1 and HGF in nasal inverted papilloma].
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
22128198 2012 Fascin expression in endocervical neoplasia: correlation with tumour morphology and growth pattern.
22110277 2011 Fascin promotes the motility and invasiveness of pancreatic cancer cells.
22076152 2011 Fascin is a key regulator of breast cancer invasion that acts via the modification of metastasis-associated molecules.
22005766 2012 Fascin, a novel marker of human hepatic stellate cells, may regulate their proliferation, migration, and collagen gene expression through the FAK-PI3K-Akt pathway.
21975550 The role of actin bundling proteins in the assembly of filopodia in epithelial cells.
21937440 2011 Signal transducers and activators of transcription 3 (STAT3) directly regulates cytokine-induced fascin expression and is required for breast cancer cell migration.
21914811 2011 Fascin protein is critical for transforming growth factor ? protein-induced invasion and filopodia formation in spindle-shaped tumor cells.
21771028 2011 Fascin expression in low-grade uterine endometrioid adenocarcinoma: correlation with microcystic, elongated and fragmented (MELF)-type alteration at the deep invasive margin.
21764699 2011 [Expression of fascin in human esophageal squamous cell carcinoma and its clinical significance].
21706053 2012 Semaphorin 5A and plexin-B3 regulate human glioma cell motility and morphology through Rac1 and the actin cytoskeleton.
21618240 2011 The roles of fascins in health and disease.
21498718 2011 Fascin and CK4 as biomarkers for esophageal squamous cell carcinoma.
21491467 2011 Fascin, an actin-bundling protein, promotes breast cancer progression in vitro.
21475911 Fascin overexpression is regulated by the transactivation of the promoter but not by its hypomethylation in esophageal squamous cell carcinoma.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21390241 2011 The prognostic impact of TGF-?1, fascin, NF-?B and PKC-? expression in soft tissue sarcomas.
21351259 2010 miR-145, miR-133a and miR-133b: Tumor-suppressive miRNAs target FSCN1 in esophageal squamous cell carcinoma.
21323792 2011 Fascin-1 expression correlates with repression of E-cadherin expression in hepatocellular carcinoma cells and augments their invasiveness in combination with matrix metalloproteinases.
21300980 2011 The tumor marker Fascin is strongly induced by the Tax oncoprotein of HTLV-1 through NF-kappaB signals.
21269460 2011 Initial characterization of the human central proteome.
21258769 2011 Restoration of miR-145 expression suppresses cell proliferation, migration and invasion in prostate cancer by targeting FSCN1.
21223690 2010 [Expression of fascin and CK14 in different histological types of cancer and its differential diagnostic significance].
21089665 2010 [The cytoskeleton and immigration of laryngeal squamous carcinoma cell affected by Fascin-1 expression].
20888270 2012 Fascin is a predictor for invasiveness and recurrence of urothelial carcinoma of bladder.
20851411 2012 Prognostic impact of fascin-1 expression is more significant in advanced colorectal cancer.
20819441 Expression of the actin-binding proteins indicates that cofilin and fascin are related to breast tumour size.
20713986 2010 Phosphorylation of fascin decreases the risk of poor survival in patients with esophageal squamous cell carcinoma.
20701077 2010 Comparison of the desmoplastic reaction and invading ability in invasive ductal carcinoma of the breast and prostatic adenocarcinoma based on the expression of heat shock protein 47 and fascin.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
20603015 2010 Identification of KIAA1018/FAN1, a DNA repair nuclease recruited to DNA damage by monoubiquitinated FANCD2.
20596974 2009 Fascin over expression is associated with dysplastic changes in sinonasal inverted papillomas: a study of 47 cases.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20434460 2010 Structure, evolutionary conservation, and conformational dynamics of Homo sapiens fascin-1, an F-actin crosslinking protein.
20393565 2010 Migrastatin analogues target fascin to block tumour metastasis.
20366178 2009 Cooperativity and frustration in protein-mediated parallel actin bundles.
20160723 2010 miR-145 and miR-133a function as tumour suppressors and directly regulate FSCN1 expression in bladder cancer.
20137952 2010 The actin-bundling protein fascin stabilizes actin in invadopodia and potentiates protrusive invasion.
20056838 2010 Involvement of CYR61 and CTGF in the fascin-mediated proliferation and invasiveness of esophageal squamous cell carcinomas cells.
20001345 2009 Knockdown of fascin1 expression suppresses the proliferation and metastasis of gastric cancer cells.
19819618 2010 Upregulated fascin1 in non-small cell lung cancer promotes the migration and invasiveness, but not proliferation.
19818782 2010 Galectin-3 increases gastric cancer cell motility by up-regulating fascin-1 expression.
19759191 2010 Fascin1 expression predicts poor prognosis in patients with nasopharyngeal carcinoma and correlates with tumor invasion.
19741544 2010 Prognostic significance of fascin-1 and E-cadherin expression in laryngeal squamous cell carcinoma.
19738613 2009 The actin-bundling protein fascin is overexpressed in colorectal adenomas and promotes motility in adenoma cells in vitro.
19729655 2009 Rab35 controls actin bundling by recruiting fascin as an effector protein.
19721413 2009 Fascin is involved in tumor necrosis factor-alpha-dependent production of MMP9 in cholangiocarcinoma.
19657566 2009 TGF-beta promotes invasion and metastasis of gastric cancer cells by increasing fascin1 expression via ERK and JNK signal pathways.
19556073 2009 Prognostic significance of fascin expression in extrahepatic bile duct carcinomas.
19483633 2009 Fascin expression in uterine smooth muscle tumors.
19340314 2009 Fascin-1 promoter activity is regulated by CREB and the aryl hydrocarbon receptor in human carcinoma cells.
19133007 2008 Recurrence of pleomorphic adenoma of the parotid gland--predictive value of cadherin-11 and fascin.
19115695 2008 Fascin can be an auxiliary immunomarker of ovarian granulosa cell tumors: comparison with calretinin and inhibin-alpha.
19061289 2008 Fascin determination in urothelial carcinomas of the urinary bladder: a marker of invasiveness.
18851787 2008 [Correlation of Epstein-Barr virus-encoded latent membrane protein 1 (LMP1) to fascin and phosphorylated Stat3 in nasopharyngeal carcinoma].
18776588 2008 Association of cortactin, fascin-1 and epidermal growth factor receptor (EGFR) expression in ovarian carcinomas: correlation with clinicopathological parameters.
18716283 2008 Rac regulates the interaction of fascin with protein kinase C in cell migration.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18599451 2008 A myosin motor that selects bundled actin for motility.
18587253 2008 Does the expression of fascin-1 and tumor subclassification help to assess the risk of recurrence and progression in t1 urothelial urinary bladder carcinoma?
18343949 2008 Expression of fascin in thyroid neoplasms: a novel diagnostic marker.
18283337 2008 The role of fascin in the migration and invasiveness of malignant glioma cells.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17671164 2007 Intrinsic dynamic behavior of fascin in filopodia.
17638895 2007 Fascin, a novel target of beta-catenin-TCF signaling, is expressed at the invasive front of human colon cancer.
17510372 2007 Association of cortactin and fascin-1 expression in gastric adenocarcinoma: correlation with clinicopathological parameters.
17473384 2007 Overexpression of fascin-1 in advanced colorectal adenocarcinoma: tissue microarray analysis of immunostaining scores with clinicopathological parameters.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17255360 2007 Liver X receptors regulate dendritic cell phenotype and function through blocked induction of the actin-bundling protein fascin.
17029629 2006 Prognostic significance of fascin expression in advanced colorectal cancer: an immunohistochemical study of colorectal adenomas and adenocarcinomas.
16977579 2006 Increasing expression of fascin in renal cell carcinoma associated with clinicopathological parameters of aggressiveness.
16533778 2006 Prognostic significance of basal-like phenotype and fascin expression in node-negative invasive breast carcinomas.
16049480 2005 Genes that mediate breast cancer metastasis to lung.
15882811 2005 Minor expression of fascin-1 gene (FSCN1) in NTera2 cells depleted of CREB-binding protein.
15671545 2005 The expression of fascin, an actin-bundling motility protein, correlates with hormone receptor-negative breast cancer and a more aggressive clinical course.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15451513 2004 Fascin protrusions in cell interactions.
15161933 2004 Comprehensive proteomic analysis of interphase and mitotic 14-3-3-binding proteins.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14535950 2003 Polarized actin bundles formed by human fascin-1: their sliding and disassembly on myosin II and myosin V in vitro.
14532112 2003 Interaction of fascin and protein kinase Calpha: a novel intersection in cell adhesion and motility.
12902483 2003 The human fascin gene promoter is highly active in mature dendritic cells due to a stage-specific enhancer.
12853948 2003 The DNA sequence of human chromosome 7.
12789270 2003 Neurotrophin-induced melanoma cell migration is mediated through the actin-bundling protein fascin.
12592367 2003 Independent prognostic value of fascin immunoreactivity in stage I nonsmall cell lung cancer.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12139639 2002 Actin-binding protein fascin expression in skin neoplasia.
12100631 2002 Fascin expression in CD30-positive cutaneous lymphoproliferative disorders.
10783262 2000 Characterization of human retinal fascin gene (FSCN2) at 17q25: close physical linkage of fascin and cytoplasmic actin genes.
9571235 1998 Fascin, an actin-bundling protein, induces membrane protrusions and increases cell motility of epithelial cells.
9565110 1998 Immunohistochemical study of actin binding protein (p55) in the human kidney.
9558080 1998 The actin-bundling protein fascin is involved in the formation of dendritic processes in maturing epidermal Langerhans cells.
9362073 1997 Characterization of cell-matrix adhesion requirements for the formation of fascin microspikes.
9033270 1997 Fascin, a sensitive new marker for Reed-Sternberg cells of hodgkin's disease. Evidence for a dendritic or B cell derivation?
8999969 1997 Identification of an actin binding region and a protein kinase C phosphorylation site on human fascin.
8970159 1996 NG2 proteoglycan and the actin-binding protein fascin define separate populations of actin-containing filopodia and lamellipodia during cell spreading and migration.
8647875 1996 Phosphorylation of human fascin inhibits its actin binding and bundling activities.
8579121 1996 Circulating human dendritic cells differentially express high levels of a 55-kd actin-bundling protein.
8068206 1994 cDNA cloning and expression of the human homolog of the sea urchin fascin and Drosophila singed genes which encodes an actin-bundling protein.
7933116 1994 Epstein-Barr virus infection induces expression in B lymphocytes of a novel gene encoding an evolutionarily conserved 55-kilodalton actin-bundling protein.
3886649 1985 Purification and characterization of an F-actin-bundling 55-kilodalton protein from HeLa cells.
3525578 1986 Intracellular localization of the 55-kD actin-bundling protein in cultured cells: spatial relationships with actin, alpha-actinin, tropomyosin, and fimbrin.
1602151 1992 Treatment of Haemophilus aphrophilus endocarditis with ciprofloxacin.