Property Summary

NCBI Gene PubMed Count 59
PubMed Score 203.34
PubTator Score 72.68

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (7)

Disease log2 FC p
astrocytic glioma 1.200 3.4e-03
ependymoma 1.400 1.4e-02
osteosarcoma 1.962 6.2e-03
atypical teratoid / rhabdoid tumor 1.100 8.5e-06
glioblastoma 1.100 1.4e-03
medulloblastoma, large-cell -1.600 2.7e-03
ovarian cancer -1.400 8.9e-07

Gene RIF (22)

PMID Text
26096936 They also demonstrate the potential of overexpressed FRS2alpha as a biomarker for prostate cancer diagnosis, prognosis and response to therapies.
25900027 Increased expression of FRS2alpha (and FGFR1) was associated with decreased progression-free survival among patients with metastatic renal cell carcinoma treated with sorafenib.
25368431 Results identify FRS2 as an oncogene in a subset of high-grade serous ovarian cancers that harbor FRS2 amplifications.
24706887 The docking protein FRS2alpha is a critical regulator of VEGF receptors signaling.
24284065 These results establish the Frs2alpha-Shp2 complex as the key mediator of FGF signaling in lens development.
23393200 Data indicate that the FGFR/FRS2 signaling axis was generally activated in about 75% of FRS2-positive high-grade liposarcomas.
22235335 a novel signaling network containing FRS2, CAP and flotillin-1
22151832 Patient with pigmentation disorders and vitiligo show decreased expression of mRNA.
21793095 Validated FRS2 amplification in both Well-differentiated liposarcoma and dedifferentiated liposarcoma.
21233699 Microdeformations produced by the combination of polyurethane foam and suction are associated with increased fibroblast proliferation and up-regulation of gene expressions in fibroblasts
21048031 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20184660 The signaling complex appears to integrate the input from FGFR and EphA4, and release the output signal through FRS2alpha.
19652666 Phosphorylation of Fibroblast growth factor receptor substrate 2alpha may function as a molecular switch in the FGF pathway, sensing and participating in crosstalk with other signaling pathways.
19111446 Mechanical wounding induces significant ROS generation at the wound edge which, in turn, induced ligand-independent KGFR and FRS2 activation via c-Src kinase signaling.
19103595 a dual mechanism where deletion of the 770YXXL773 motif promotes FGFR2 IIIb C3 transforming activity by causing aberrant receptor recycling and stability and persistent FRS2-dependent signaling.
18591461 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18189271 an important function for FRS2 is to concentrate RET in membrane foci, leading to an engagement of specific signaling complexes localized in these membrane domains
17145761 Bisindolylmaleimide I does not inhibit FGF2-induced tyrosine phosphorylation of Frs2.
15564375 FRS2-dependent SRC activation is required for FGFR-induced phosphorylation of Sprouty and suppression of ERK activity
12974390 findings support a broader role of FRS2 in EGFR-controlled signaling pathways in A-431 cells and provide insight into a molecular mechanism for ligand-stimulated feedback regulation with FRS2 as a central regulatory switch point
12571252 FRS2 has a role in fibroblast growth factor-2-induced signaling
11877385 FRS2 PTB domain conformation regulates interactions with divergent neurotrophic receptors

AA Sequence

MGSCCSCPDKDTVPDNHRNKFKVINVDDDGNELGSGIMELTDTELILYTRKRDSVKWHYLCLRRYGYDSN      1 - 70
LFSFESGRRCQTGQGIFAFKCARAEELFNMLQEIMQNNSINVVEEPVVERNNHQTELEVPRTPRTPTTPG     71 - 140
FAAQNLPNGYPRYPSFGDASSHPSSRHPSVGSARLPSVGEESTHPLLVAEEQVHTYVNTTGVQEERKNRT    141 - 210
SVHVPLEARVSNAESSTPKEEPSSIEDRDPQILLEPEGVKFVLGPTPVQKQLMEKEKLEQLGRDQVSGSG    211 - 280
ANNTEWDTGYDSDERRDAPSVNKLVYENINGLSIPSASGVRRGRLTSTSTSDTQNINNSAQRRTALLNYE    281 - 350
NLPSLPPVWEARKLSRDEDDNLGPKTPSLNGYHNNLDPMHNYVNTENVTVPASAHKIEYSRRRDCTPTVF    351 - 420
NFDIRRPSLEHRQLNYIQVDLEGGSDSDNPQTPKTPTTPLPQTPTRRTELYAVIDIERTAAMSNLQKALP    421 - 490
RDDGTSRKTRHNSTDLPM                                                        491 - 508
//

Text Mined References (68)

PMID Year Title
26096936 2016 Hyperactivated FRS2?-mediated signaling in prostate cancer cells promotes tumor angiogenesis and predicts poor clinical outcome of patients.
25900027 2015 The impact of FGFR1 and FRS2? expression on sorafenib treatment in metastatic renal cell carcinoma.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25429064 2015 Meta-analysis of genome-wide association studies of adult height in East Asians identifies 17 novel loci.
25368431 2015 The Tyrosine Kinase Adaptor Protein FRS2 Is Oncogenic and Amplified in High-Grade Serous Ovarian Cancer.
24706887 2014 The docking protein FRS2? is a critical regulator of VEGF receptors signaling.
24284065 2014 Frs2? and Shp2 signal independently of Gab to mediate FGF signaling in lens development.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23563607 2013 Genome-wide meta-analysis identifies 11 new loci for anthropometric traits and provides insights into genetic architecture.
23393200 2013 Amplification of FRS2 and activation of FGFR/FRS2 signaling pathway in high-grade liposarcoma.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22235335 2012 Molecular networks in FGF signaling: flotillin-1 and cbl-associated protein compete for the binding to fibroblast growth factor receptor substrate 2.
22151832 2013 Basic fibroblast growth factor and tumour necrosis factor alpha in vitiligo and other hypopigmented disorders: suggestive possible therapeutic targets.
21793095 2011 High-resolution genomic mapping reveals consistent amplification of the fibroblast growth factor receptor substrate 2 gene in well-differentiated and dedifferentiated liposarcoma.
21765395 2011 Nedd4-1 binds and ubiquitylates activated FGFR1 to control its endocytosis and function.
21233699 2011 Microdeformation of three-dimensional cultured fibroblasts induces gene expression and morphological changes.
21048031 2011 Single nucleotide polymorphisms of matrix metalloproteinase 9 (MMP9) and tumor protein 73 (TP73) interact with Epstein-Barr virus in chronic lymphocytic leukemia: results from the European case-control study EpiLymph.
20881960 2010 Hundreds of variants clustered in genomic loci and biological pathways affect human height.
20184660 2010 Ternary complex formation of EphA4, FGFR and FRS2? plays an important role in the proliferation of embryonic neural stem/progenitor cells.
20094046 2010 Fibroblast growth factor signalling: from development to cancer.
19652666 2009 FGF-receptor substrate 2 functions as a molecular sensor integrating external regulatory signals into the FGF pathway.
19111446 2009 An in vitro analysis of mechanical wounding-induced ligand-independent KGFR activation.
19103595 2009 Aberrant receptor internalization and enhanced FRS2-dependent signaling contribute to the transforming activity of the fibroblast growth factor receptor 2 IIIb C3 isoform.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18591461 2008 Genomic association analysis suggests chromosome 12 locus influencing antihypertensive response to thiazide diuretic.
18452557 2008 Regulation of growth factor signaling by FRS2 family docking/scaffold adaptor proteins.
18391951 2008 Many sequence variants affecting diversity of adult human height.
18189271 2008 Cell migration by a FRS2-adaptor dependent membrane relocation of ret receptors.
17274988 2007 ALK activation induces Shc and FRS2 recruitment: Signaling and phenotypic outcomes in PC12 cells differentiation.
17145761 2007 Bisindolylmaleimide I suppresses fibroblast growth factor-mediated activation of Erk MAP kinase in chondrocytes by preventing Shp2 association with the Frs2 and Gab1 adaptor proteins.
16541075 2006 The finished DNA sequence of human chromosome 12.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16284401 2006 Identification of a switch in neurotrophin signaling by selective tyrosine phosphorylation.
15738000 2005 Direct interaction of Rnd1 with FRS2 beta regulates Rnd1-induced down-regulation of RhoA activity and is involved in fibroblast growth factor-induced neurite outgrowth in PC12 cells.
15564375 2004 FRS2-dependent SRC activation is required for fibroblast growth factor receptor-induced phosphorylation of Sprouty and suppression of ERK activity.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15488758 2004 TrkA alternative splicing: a regulated tumor-promoting switch in human neuroblastoma.
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12974390 2003 EGFR and FGFR signaling through FRS2 is subject to negative feedback control by ERK1/2.
12766061 2003 Gene expression profile of the human trabecular meshwork: NEIBank sequence tag analysis.
12688531 2003 Genomic organization and comparative sequence analysis of the mouse and human FRS2, FRS3 genes.
12660731 2003 The role of PI3K in immune cells.
12571252 2003 Fibroblast growth factor-2-induced signaling through lipid raft-associated fibroblast growth factor receptor substrate 2 (FRS2).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12419216 2002 The docking protein FRS2alpha controls a MAP kinase-mediated negative feedback mechanism for signaling by FGF receptors.
12402043 2002 Sprouty1 and Sprouty2 provide a control mechanism for the Ras/MAPK signalling pathway.
12154000 2002 Fibroblast growth factor receptor substrate 2 participates in vascular endothelial growth factor-induced signaling.
11997436 2002 FRS2 alpha attenuates FGF receptor signaling by Grb2-mediated recruitment of the ubiquitin ligase Cbl.
11877385 2002 FRS2 PTB domain conformation regulates interactions with divergent neurotrophic receptors.
11447289 2001 Critical role for the docking-protein FRS2 alpha in FGF receptor-mediated signal transduction pathways.
11360177 2001 Identification of SNT/FRS2 docking site on RET receptor tyrosine kinase and its role for signal transduction.
11353842 2001 Stimulation of phosphatidylinositol 3-kinase by fibroblast growth factor receptors is mediated by coordinated recruitment of multiple docking proteins.
11090629 2000 Structural basis of SNT PTB domain interactions with distinct neurotrophic receptors.
10822386 2000 Specific inhibition of FGF-induced MAPK activation by the receptor-like protein tyrosine phosphatase LAR.
10783152 2000 Discoidin domain receptor 1 (DDR1) signaling in PC12 cells: activation of juxtamembrane domains in PDGFR/DDR/TrkA chimeric receptors.
10650943 2000 Potential involvement of FRS2 in insulin signaling.
10629055 2000 FRS2 proteins recruit intracellular signaling pathways by binding to diverse targets on fibroblast growth factor and nerve growth factor receptors.
10383403 1999 Association of atypical protein kinase C isotypes with the docker protein FRS2 in fibroblast growth factor signaling.
10092678 1999 The signaling adapter FRS-2 competes with Shc for binding to the nerve growth factor receptor TrkA. A model for discriminating proliferation and differentiation.
9660748 1998 Novel recognition motif on fibroblast growth factor receptor mediates direct association and activation of SNT adapter proteins.
9632781 1998 Binding of Shp2 tyrosine phosphatase to FRS2 is essential for fibroblast growth factor-induced PC12 cell differentiation.
9182757 1997 A lipid-anchored Grb2-binding protein that links FGF-receptor activation to the Ras/MAPK signaling pathway.
9069267 1997 Signal transduction by the neurotrophin receptors.
9045692 1997 Signal transduction pathway of human fibroblast growth factor receptor 3. Identification of a novel 66-kDa phosphoprotein.
8780727 1996 Suc1-associated neurotrophic factor target (SNT) protein is a major FGF-stimulated tyrosine phosphorylated 90-kDa protein which binds to the SH2 domain of GRB2.
8761293 1996 Broadly expressed SNT-like proteins link FGF receptor stimulation to activators of Ras.
7806500 1994 Four proline-rich sequences of the guanine-nucleotide exchange factor C3G bind with unique specificity to the first Src homology 3 domain of Crk.