Property Summary

NCBI Gene PubMed Count 6
PubMed Score 31.89
PubTator Score 12.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
malignant mesothelioma -1.700 2.9e-05
astrocytoma -3.100 1.5e-02
ependymoma -2.500 9.9e-10
glioblastoma -4.500 9.9e-04
oligodendroglioma -1.900 4.5e-12
group 3 medulloblastoma -3.000 8.1e-04
atypical teratoid / rhabdoid tumor -4.000 1.2e-06
medulloblastoma, large-cell -4.000 7.7e-07
primitive neuroectodermal tumor -2.100 1.9e-02
adrenocortical carcinoma -1.389 3.7e-02
colon cancer -2.100 6.8e-07
adult high grade glioma -3.800 1.4e-06
pilocytic astrocytoma -1.400 1.0e-05
subependymal giant cell astrocytoma -4.364 8.9e-03
lung carcinoma 3.500 4.4e-47
ovarian cancer 1.500 2.6e-10
pituitary cancer 1.200 7.5e-08
psoriasis -1.100 4.3e-10

Synonym

Accession Q9P0K9 Q5T4G4
Symbols CG6
CG-6
C9orf4
EIEE37

Gene

  Ortholog (1)

Species Source Disease
Mouse OMA Inparanoid

AA Sequence

MRRPRQGGGGAGGSAAARARAGGLGGGSVPARARGAPAAARAAWLRDLCARMARPPRQHPGVWASLLLLL      1 - 70
LTGPAACAASPADDGAGPGGRGPRGRARGDTGADEAVPRHDSSYGTFAGEFYDLRYLSEEGYPFPTAPPV     71 - 140
DPFAKIKVDDCGKTKGCFRYGKPGCNAETCDYFLSYRMIGADVEFELSADTDGWVAVGFSSDKKMGGDDV    141 - 210
MACVHDDNGRVRIQHFYNVGQWAKEIQRNPARDEEGVFENNRVTCRFKRPVNVPRDETIVDLHLSWYYLF    211 - 280
AWGPAIQGSITRHDIDSPPASERVVSIYKYEDIFMPSAAYQTFSSPFCLLLIVALTFYLLMGTP          281 - 344
//

Text Mined References (6)

PMID Year Title
27239025 2016 Epileptic encephalopathy with continuous spike-and-wave during sleep maps to a homozygous truncating mutation in AMPA receptor component FRRS1L.
27236917 2016 Loss-of-Function Mutations in FRRS1L Lead to an Epileptic-Dyskinetic Encephalopathy.
15164053 2004 DNA sequence and analysis of human chromosome 9.
10603000 2000 Cloning, mapping, and expression of a novel brain-specific transcript in the familial dysautonomia candidate region on chromosome 9q31.
9110174 1997 Large-scale concatenation cDNA sequencing.
8619474 1996 A "double adaptor" method for improved shotgun library construction.