Property Summary

NCBI Gene PubMed Count 22
PubMed Score 131.00
PubTator Score 124.38

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
adrenocortical carcinoma -1.278 2.3e-02
aldosterone-producing adenoma -1.245 3.1e-02
Astrocytoma, Pilocytic 1.100 3.4e-03
Breast cancer -1.700 2.7e-08
breast carcinoma -1.100 4.1e-18
Duchenne muscular dystrophy 1.063 1.1e-06
ependymoma 1.700 9.2e-03
gastric carcinoma 1.600 4.2e-02
interstitial cystitis -1.300 5.3e-04
intraductal papillary-mucinous adenoma (... -1.500 2.0e-02
intraductal papillary-mucinous carcinoma... -1.500 4.5e-02
juvenile dermatomyositis 1.273 8.5e-11
non-small cell lung cancer 1.978 8.4e-14
oligodendroglioma 1.100 5.0e-02
osteosarcoma 2.716 2.1e-03
ovarian cancer -3.000 3.2e-09
pancreatic cancer 2.400 7.0e-03
pituitary cancer -1.100 3.8e-03
primary pancreatic ductal adenocarcinoma 1.926 4.7e-03
sonic hedgehog group medulloblastoma 1.200 1.2e-02
spina bifida -2.607 3.6e-02
subependymal giant cell astrocytoma -1.285 2.4e-02
tuberculosis -1.600 2.0e-06
ulcerative colitis 1.300 3.4e-03

Protein-protein Interaction (4)

Gene RIF (5)

AA Sequence

MNKLNFHNNRVMQDRRSVCIFLPNDESLNIIINVKILCHQLLVQVCDLLRLKDCHLFGLSVIQNNEHVYM      1 - 70
ELSQKLYKYCPKEWKKEASKVRQYEVTWGIDQFGPPMIIHFRVQYYVENGRLISDRAARYYYYWHLRKQV     71 - 140
LHSQCVLREEAYFLLAAFALQADLGNFKRNKHYGKYFEPEAYFPSWVVSKRGKDYILKHIPNMHKDQFAL    141 - 210
TASEAHLKYIKEAVRLDDVAVHYYRLYKDKREIEASLTLGLTMRGIQIFQNLDEEKQLLYDFPWTNVGKL    211 - 280
VFVGKKFEILPDGLPSARKLIYYTGCPMRSRHLLQLLSNSHRLYMNLQPVLRHIRKLEENEEKKQYRESY    281 - 350
ISDNLDLDMDQLEKRSRASGSSAGSMKHKRLSRHSTASHSSSHTSGIEADTKPRDTGPEDSYSSSAIHRK    351 - 420
LKTCSSMTSHGSSHTSGVESGGKDRLEEDLQDDEIEMLVDDPRDLEQMNEESLEVSPDMCIYITEDMLMS    421 - 490
RKLNGHSGLIVKEIGSSTSSSSETVVKLRGQSTDSLPQTICRKPKTSTDRHSLSLDDIRLYQKDFLRIAG    491 - 560
LCQDTAQSYTFGCGHELDEEGLYCNSCLAQQCINIQDAFPVKRTSKYFSLDLTHDEVPEFVV            561 - 622
//

Text Mined References (27)

PMID Year Title