Property Summary

NCBI Gene PubMed Count 13
PubMed Score 4.73
PubTator Score 6.16

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
psoriasis 1.100 6.9e-04
oligodendroglioma -1.100 1.4e-04
osteosarcoma 1.045 2.8e-02
glioblastoma 1.300 3.6e-04
group 3 medulloblastoma 2.900 1.1e-03
primitive neuroectodermal tumor 1.900 9.9e-05
adrenocortical carcinoma -1.199 8.0e-03
non-small cell lung cancer -1.384 2.0e-17
intraductal papillary-mucinous adenoma (... 1.200 3.6e-02
lung cancer -1.800 2.4e-03
diabetes mellitus -1.100 1.7e-03
lung adenocarcinoma -1.200 4.1e-13
pilocytic astrocytoma 1.100 2.0e-02
nasopharyngeal carcinoma -1.200 2.3e-03
lung carcinoma -1.900 8.2e-28
Breast cancer -1.400 4.8e-08
mucosa-associated lymphoid tissue lympho... 1.169 2.2e-02
invasive ductal carcinoma -1.300 5.3e-04
ovarian cancer -2.700 1.1e-05
pituitary cancer 1.900 2.5e-03
Down syndrome 1.500 2.3e-03

Gene RIF (6)

PMID Text
20718813 association between the intronic rs6787362 FRMD4B SNP and ischemic cardiomyopathy in a European-derived population, but not FRMD4B variants as susceptibility factors in common heart failure
20718813 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20124441 SNP is located in a 3' intronic region of the FRMD4B gene. FRMD4B as novel susceptibility loci for advanced heart failure.
19913121 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MASVFMCGVEDLLFSGSRFVWNLTVSTLRRWYTERLRACHQVLRTWCGLQDVYQMTEGRHCQVHLLDDRR      1 - 70
LELLVQPKLLARELLDLVASHFNLKEKEYFGITFIDDTGQQNWLQLDHRVLDHDLPKKPGPTILHFAVRF     71 - 140
YIESISFLKDKTTVELFFLNAKACVHKGQIEVESETIFKLAAFILQEAKGDYTSDENARKDLKTLPAFPT    141 - 210
KTLQEHPSLAYCEDRVIEHYLKIKGLTRGQAVVQYMKIVEALPTYGVHYYAVKDKQGLPWWLGISYKGIG    211 - 280
QYDIQDKVKPRKLFQWKQLENLYFREKKFAVEVHDPRRISVSRRTFGQSGLFVQTWYANSSLIKSIWVMA    281 - 350
ISQHQFYLDRKQSKAKIPSARSLDEIAMDLTETGTQRASKLVTLETKSQFIMASNGSLISSGSQDSEVSE    351 - 420
EQKREKILELKKKEKLLQEKLLKKVEELKKICLREAELTGKMPKEYPLNIGEKPPQVRRRVGTAFKLDDN    421 - 490
LLPSEEDPALQELESNFLIQQKLVEAAKKLANEPDLCKTVKKKRKQDYTDAMKKLQEIENAINEYRIRCG    491 - 560
KKPSQKATVLPEDIIPSESSSLSDTTTYDDPSDAFTFPGQRSSSVPHSPRILPPKSLGIERIHFRKSSIN    561 - 630
EQFVDTRQSREMLSTHSSPYKTLERRPQGGRSMPTTPVLTRNAYSSSHLEPESSSQHCRQRSGSLESQSH    631 - 700
LLSEMDSDKPFFSLSKSQRSSSTEILDDGSSYTSQSSTEYYCVTPVTGPYYTTQTLDTRTRGRRRSKKQN    701 - 770
VSTSNSGSMPNLAQKDSLRNGVYSKSQEPPSSSYYIAGYTPYAECDFYYSGGYVYENDTEGQYSVNPSYR    771 - 840
SSAHYGYERQRDYSRSFHEDEVDRVPHNPYATLRLPRKAAAKSEHITKNIHKALVAEHLRGWYQRASGQK    841 - 910
DQGHSPQTSFDSDRGSQRCLGFAGLQVPCSPSSRASSYSSVSSTNASGNWRTQLTIGLSDYETPAHSSYT    911 - 980
SCYGNVYNPLPSPSRQYTEISQLDGTDGNQLEDNLESSEQRLFWHEDSKPGTLV                    981 - 1034
//

Text Mined References (16)

PMID Year Title
23580065 2013 Shotgun proteomics reveals specific modulated protein patterns in tears of patients with primary open angle glaucoma naïve to therapy.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
20718813 2010 Association of an intronic, but not any exonic, FRMD4B sequence variant and heart failure.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20190752 2010 Multiple common variants for celiac disease influencing immune gene expression.
20124441 2010 Common variants in HSPB7 and FRMD4B associated with advanced heart failure.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
18088087 2008 Phosphoproteome of resting human platelets.
17903296 2007 Genome-wide association with bone mass and geometry in the Framingham Heart Study.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11445584 2001 Signaling complexes of the FERM domain-containing protein GRSP1 bound to ARF exchange factor GRP1.
10231032 1999 Prediction of the coding sequences of unidentified human genes. XIII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.