Property Summary

NCBI Gene PubMed Count 11
PubMed Score 16.85
PubTator Score 18.45

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
Rheumatoid Arthritis 2.000 9.2e-03
pancreatic cancer 1.700 1.5e-03
osteosarcoma -2.222 1.6e-03
Duchenne muscular dystrophy -1.149 5.4e-08
acute quadriplegic myopathy -1.802 1.6e-07
adrenocortical carcinoma -1.572 2.9e-03
tuberculosis 1.600 2.0e-05
non-small cell lung cancer -2.630 1.1e-25
cystic fibrosis -1.100 8.7e-04
lung adenocarcinoma -1.700 3.4e-24
group 4 medulloblastoma -1.400 2.1e-03
pancreatic carcinoma 1.700 1.5e-03
psoriasis -1.200 3.9e-07
subependymal giant cell astrocytoma 2.336 1.5e-02
invasive ductal carcinoma -2.400 1.0e-04
ductal carcinoma in situ -1.600 1.3e-04
ovarian cancer -1.500 4.2e-02

Gene RIF (7)

PMID Text
26909942 The risk (G and C) and non-risk (C and T) allele frequencies of the SNPs at the rs1888747 and rs739401 loci of FRMD3 and CARS, respectively, did not differ significantly between the diabetics with (case) and without (control) nephropathy (P > 0.05).
23434934 model for FRMD3 in diabetic nephropathy proposes a possible transcriptional link through which the polymorphism in the FRMD3 promoter could influence transcriptional regulation within the bone morphogenetic protein (BMP)-signaling pathway
21698141 These analyses reveal a role for FRMD3 in AA T2DN susceptibility.
20460425 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19252134 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
17260017 identify FRMD3 as a novel putative tumour suppressor gene suggesting an important role in the origin and progression of lung cancer.

AA Sequence

MFASCHCVPRGRRTMKMIHFRSSSVKSLSQEMRCTIRLLDDSEISCHIQRETKGQFLIDHICNYYSLLEK      1 - 70
DYFGIRYVDPEKQRHWLEPNKSIFKQMKTHPPYTMCFRVKFYPHEPLKIKEELTRYLLYLQIKRDIFHGR     71 - 140
LLCSFSDAAYLGACIVQAELGDYDPDEHPENYISEFEIFPKQSQKLERKIVEIHKNELRGQSPPVAEFNL    141 - 210
LLKAHTLETYGVDPHPCKDSTGTTTFLGFTAAGFVVFQGNKRIHLIKWPDVCKLKFEGKTFYVIGTQKEK    211 - 280
KAMLAFHTSTPAACKHLWKCGVENQAFYKYAKSSQIKTVSSSKIFFKGSRFRYSGKVAKEVVEASSKIQR    281 - 350
EPPEVHRANITQSRSSHSLNKQLIINMEPLQPLLPSPSEQEEELPLGEGVPLPKEENISAPLISSSPVKA    351 - 420
AREYEDPPSEEEDKIKEEPLTISELVYNPSASLLPTPVDDDEIDMLFDCPSRLELEREDTDSFEDLEADE    421 - 490
NAFLIAEEEELKEARRALSWSYDILTGHIRVNPLVKSFSRLLVVGLGLLLFVFPLLLLLLESGIDLSFLC    491 - 560
EIRQTPEFEQFHYEYYCPLKEWVAGKVHLILYMLGCS                                     561 - 597
//

Text Mined References (14)

PMID Year Title
26909942 2016 Evaluation of associations between single nucleotide polymorphisms in the FRMD3 and CARS genes and diabetic nephropathy in a Kuwaiti population.
23434934 2013 From single nucleotide polymorphism to transcriptional mechanism: a model for FRMD3 in diabetic nephropathy.
21698141 2011 Differential effects of MYH9 and APOL1 risk variants on FRMD3 Association with Diabetic ESRD in African Americans.
20460425 2010 Replication study for the association between four Loci identified by a genome-wide association study on European American subjects with type 1 diabetes and susceptibility to diabetic nephropathy in Japanese subjects with type 2 diabetes.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19252134 2009 Genome-wide association scan for diabetic nephropathy susceptibility genes in type 1 diabetes.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17260017 2007 FRMD3, a novel putative tumour suppressor in NSCLC.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12601556 2003 Molecular cloning and characterization of the protein 4.1O gene, a novel member of the protein 4.1 family with focal expression in ovary.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.