Property Summary

Ligand Count 12
NCBI Gene PubMed Count 33
PubMed Score 49.17
PubTator Score 72.25

Knowledge Summary

Patent (17,534)

Expression

  Differential Expression (11)

Gene RIF (17)

AA Sequence

MSNICQRLWEYLEPYLPCLSTEADKSTVIENPGALCSPQSQRHGHYFVALFDYQARTAEDLSFRAGDKLQ      1 - 70
VLDTLHEGWWFARHLEKRRDGSSQQLQGYIPSNYVAEDRSLQAEPWFFGAIGRSDAEKQLLYSENKTGSF     71 - 140
LIRESESQKGEFSLSVLDGAVVKHYRIKRLDEGGFFLTRRRIFSTLNEFVSHYTKTSDGLCVKLGKPCLK    141 - 210
IQVPAPFDLSYKTVDQWEIDRNSIQLLKRLGSGQFGEVWEGLWNNTTPVAVKTLKPGSMDPNDFLREAQI    211 - 280
MKNLRHPKLIQLYAVCTLEDPIYIITELMRHGSLQEYLQNDTGSKIHLTQQVDMAAQVASGMAYLESRNY    281 - 350
IHRDLAARNVLVGEHNIYKVADFGLARVFKVDNEDIYESRHEIKLPVKWTAPEAIRSNKFSIKSDVWSFG    351 - 420
ILLYEIITYGKMPYSGMTGAQVIQMLAQNYRLPQPSNCPQQFYNIMLECWNAEPKERPTFETLRWKLEDY    421 - 490
FETDSSYSDANNFIR                                                           491 - 505
//

Text Mined References (39)

PMID Year Title