Property Summary

NCBI Gene PubMed Count 31
PubMed Score 43.06
PubTator Score 72.25

Knowledge Summary

Patent (17,534)

Expression

  Differential Expression (11)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (15)

PMID Text
25783528 antagomir-1290 significantly inhibited the proliferation, clonogenicity, invasion, and migration of CD133(+) cells by targeting fyn-related Src family tyrosine kinase.
24969324 FRK over-expression promoted beta-catenin translocation to the plasma membrane, where it formed complex with N-cadherin.
24792491 our results demonstrate a combined mechanism for the anti-proliferative effects of FRK by inhibiting cyclin D1 nucleus accumulation and pRb phosphorylation in glioma cells.
24735922 exome sequencing identified recurrent somatic FRK mutations that induce constitutive kinase activity, STAT3 activation, and cell proliferation sensitive to Src inhibitors
23318459 Data indicaate that the Rak/Frk SH2 and SH3 domains collaborate to increase the Rak-EGFR interaction.
23267173 The expression levels of FRK were significantly correlated with invasiveness in both Hep3B and HepG2 tumor cell lines.
22790444 these results clearly indicate that FRK may play a protective role against the progression of glioma by suppressing cell migration and invasion
21665990 Genetic variation near FRK/COL10A1 and VEGFA are associated with advanced age-related macular degeneration.
21074287 Study searched for mutations in the FRK gene, a recently identified tumor suppressor gene, for the first time in NSCLC. Somatic FRK mutations were found at a very low frequency in NSCLCs.
20800603 Observational study of gene-disease association. (HuGE Navigator)
19345329 Rak functions as a tumor suppressor by regulating PTEN protein stability and function in breast and bone neoplasms.
15082191 Three common Japanese polymorphisms of the Fyn kinase gene studied in 127 healthy controls and 182 sporadic Alzheimer's disease failed to demonstrate any significant difference.
12750000 Observational study of gene-disease association. (HuGE Navigator)
12725532 The tyrosine kinases Brk/PTK6/Sik, Srm, Frk/Rak/Gtk/Iyk/Bsk, and Src42A/Dsrc41 have a low degree of sequence homology to other known kinases. The exon structure of these kinases, called the Brk family, is highly conserved and distinct.
12569567 Breast cancer cell line proliferation blocked by the Src-related Rak tyrosine kinase

AA Sequence

MSNICQRLWEYLEPYLPCLSTEADKSTVIENPGALCSPQSQRHGHYFVALFDYQARTAEDLSFRAGDKLQ      1 - 70
VLDTLHEGWWFARHLEKRRDGSSQQLQGYIPSNYVAEDRSLQAEPWFFGAIGRSDAEKQLLYSENKTGSF     71 - 140
LIRESESQKGEFSLSVLDGAVVKHYRIKRLDEGGFFLTRRRIFSTLNEFVSHYTKTSDGLCVKLGKPCLK    141 - 210
IQVPAPFDLSYKTVDQWEIDRNSIQLLKRLGSGQFGEVWEGLWNNTTPVAVKTLKPGSMDPNDFLREAQI    211 - 280
MKNLRHPKLIQLYAVCTLEDPIYIITELMRHGSLQEYLQNDTGSKIHLTQQVDMAAQVASGMAYLESRNY    281 - 350
IHRDLAARNVLVGEHNIYKVADFGLARVFKVDNEDIYESRHEIKLPVKWTAPEAIRSNKFSIKSDVWSFG    351 - 420
ILLYEIITYGKMPYSGMTGAQVIQMLAQNYRLPQPSNCPQQFYNIMLECWNAEPKERPTFETLRWKLEDY    421 - 490
FETDSSYSDANNFIR                                                           491 - 505
//

Text Mined References (37)

PMID Year Title
25783528 2015 Antagomir-1290 suppresses CD133? cells in non-small cell lung cancer by targeting fyn-related Src family tyrosine kinase.
25416956 2014 A proteome-scale map of the human interactome network.
24969324 2015 FRK inhibits migration and invasion of human glioma cells by promoting N-cadherin/?-catenin complex formation.
24792491 2014 FRK suppresses the proliferation of human glioma cells by inhibiting cyclin D1 nuclear accumulation.
24735922 2014 Genomic profiling of hepatocellular adenomas reveals recurrent FRK-activating mutations and the mechanisms of malignant transformation.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24097068 2013 Discovery and refinement of loci associated with lipid levels.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23318459 2014 The Rak/Frk tyrosine kinase associates with and internalizes the epidermal growth factor receptor.
23267173 2013 In silico identification of oncogenic potential of fyn-related kinase in hepatocellular carcinoma.
23263486 2013 Genome-wide association analyses identify 18 new loci associated with serum urate concentrations.
22790444 2012 FRK controls migration and invasion of human glioma cells by regulating JNK/c-Jun signaling.
21665990 2011 Common variants near FRK/COL10A1 and VEGFA are associated with advanced age-related macular degeneration.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21074287 2011 Mutation analysis of the FRK gene in non-small cell lung cancers.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20686565 2010 Biological, clinical and population relevance of 95 loci for blood lipids.
19652529 2009 RAKing in AKT: a tumor suppressor function for the intracellular tyrosine kinase FRK.
19345329 2009 Rak functions as a tumor suppressor by regulating PTEN protein stability and function.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
15951569 2005 Time-resolved mass spectrometry of tyrosine phosphorylation sites in the epidermal growth factor receptor signaling network reveals dynamic modules.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15082191 2004 No genetic association between Fyn kinase gene polymorphisms (-93A/G, IVS10+37T/C and Ex12+894T/G) and Japanese sporadic Alzheimer's disease.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12837246 2003 Multiple tumor suppressor pathways negatively regulate telomerase.
12750000 2003 No genetic association between polymorphisms in the Fyn kinase gene and age of schizophrenic onset.
12725532 2003 Brk, Srm, Frk, and Src42A form a distinct family of intracellular Src-like tyrosine kinases.
12569567 2003 Breast cancer cell line proliferation blocked by the Src-related Rak tyrosine kinase.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8099900 1993 Novel protein kinases expressed in human breast cancer.
7696183 1994 Rak, a novel nuclear tyrosine kinase expressed in epithelial cells.
7664264 1995 The nuclear tyrosine kinase Rak associates with the retinoblastoma protein pRb.
7510261 1994 Cloning of FRK, a novel human intracellular SRC-like tyrosine kinase-encoding gene.