Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6685 1.9e-06
facioscapulohumeral dystrophy 286 6.1e-04
Disease Target Count Z-score Confidence
Ankylosing spondylitis 138 3.04 1.5

Expression

  Differential Expression (2)

Disease log2 FC p
psoriasis -1.400 1.9e-06
facioscapulohumeral dystrophy 2.700 6.1e-04

AA Sequence

MGKGNEDPDLHCSSIQCSTDQPPFQQISFTEKGSDEKKPFKGKGKTAFSHSSEKHTQRQAGSDPNPNKEN      1 - 70
SEETKLKAGNSTAGSEPESSSYQENCRKRKISSKDICQDRAGNCPEEECNLTLNKKSRSSTAVHNSEIQE     71 - 140
TCDAHHRGSSRACTGRSKRHRSRALEVQTPSLRKSLVTSVRAMSEAVYQDLAQVWAQQIHSPLTCEQLTL    141 - 210
LTRLRGPLCAQVQTLYSMATQAAYVFPAESWLVPATLPGPGDSALDREAHPFPGQEITEPVSGSDEAKLG    211 - 280
AP                                                                        281 - 282
//

Text Mined References (3)

PMID Year Title
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
15520407 2004 FRG2, an FSHD candidate gene, is transcriptionally upregulated in differentiating primary myoblast cultures of FSHD patients.
11245978 2001 Active genes in junk DNA? Characterization of DUX genes embedded within 3.3 kb repeated elements.