Property Summary

NCBI Gene PubMed Count 7
PubMed Score 3.52
PubTator Score 5.12

Knowledge Summary

Patent

No data available

TINX Plot

Gene RIF (4)

AA Sequence

MGKGNEDSDLHCSSIQCSTDQPPFQQISFTEKGSDEKKPFKEKGKTAFSHSSEKHIQRQGSEPNPNKENS      1 - 70
EETKLKAGNSTAGSEPESSSYRENCRKRKMSSKDSCQDTAGNCPEKECSLSLNKKSRSSTAVHNSEIQET     71 - 140
CDAHHRGHSRACTGHSKRHRSRALGVQTPSIRKSLVTSVRAMSEAVYQDLAQVWAQQIHSPLTCEQLTLL    141 - 210
TRLRGPLCAQVQTLYSMATQAAYVFPAESWLVPATLPGPGESALDREAHPFPGQEITETVSGSDEAKL      211 - 278
//

Text Mined References (9)

PMID Year Title