Property Summary

NCBI Gene PubMed Count 27
PubMed Score 12.20
PubTator Score 24.36

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Facioscapulohumeral muscular dystrophy 1a 1 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

Gene RIF (15)

AA Sequence

MAEYSYVKSTKLVLKGTKTKSKKKKSKDKKRKREEDEETQLDIVGIWWTVTNFGEISGTIAIEMDKGTYI      1 - 70
HALDNGLFTLGAPHKEVDEGPSPPEQFTAVKLSDSRIALKSGYGKYLGINSDGLVVGRSDAIGPREQWEP     71 - 140
VFQNGKMALLASNSCFIRCNEAGDIEAKSKTAGEEEMIKIRSCAERETKKKDDIPEEDKGNVKQCEINYV    141 - 210
KKFQSFQDHKLKISKEDSKILKKARKDGFLHETLLDRRAKLKADRYCK                          211 - 258
//

Text Mined References (29)

PMID Year Title