Property Summary

NCBI Gene PubMed Count 11
PubMed Score 4.55
PubTator Score 5.34

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
malignant mesothelioma 3232 4.7e-07
pituitary cancer 1972 2.8e-04
ovarian cancer 8520 4.7e-04
osteosarcoma 7950 8.8e-04

Expression

  Differential Expression (4)

Disease log2 FC p
malignant mesothelioma 2.000 4.7e-07
osteosarcoma -2.155 8.8e-04
ovarian cancer 1.100 4.7e-04
pituitary cancer 1.200 2.8e-04

 MGI Phenotype (1)

Protein-protein Interaction (8)

Gene RIF (3)

AA Sequence

MPCRREEEEEAGEEAEGEEEEDDSFLLLQQSVTLGSSGEVDRLVAQIGETLQLDAAQDSPASPCAPPGVP      1 - 70
LRAPGPLAAAVPADKARPPAVPLLLPPASAETVGPAPSGALRCALGDRGRVRGRAAPYCVAEVAAGPSAL     71 - 140
PGPCRRGWLRDAVTSRRLQQRRWTQAGARAGDDDPHRLLQQLVLSGNLIKEAVRRLQRAVAAVAATGPAS    141 - 210
APGPGGGRSGPDRIALQPSGSLL                                                   211 - 233
//

Text Mined References (11)

PMID Year Title