Property Summary

NCBI Gene PubMed Count 27
PubMed Score 22.89
PubTator Score 23.84

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
pituitary cancer 1972 2.3e-05
osteosarcoma 7933 2.3e-04
psoriasis 6685 6.0e-04
Disease Target Count Z-score Confidence
Cancer 2346 0.0 4.0

Expression

  Differential Expression (3)

Disease log2 FC p
psoriasis 1.300 6.0e-04
osteosarcoma -2.428 2.3e-04
pituitary cancer 1.400 2.3e-05

 MGI Phenotype (1)

Protein-protein Interaction (1)

Gene RIF (14)

PMID Text
26178481 FRAT1 and ABCG2 overexpression is associated with carcinogenesis, progression, and poor prognosis in patients with Pancreatic ductal adenocarcinoma.
25922553 FRAT1 overexpression correlates with pathologic grade, proliferation, invasion and angiogenesis in brain gliomas.
25387569 Positive ROR2 and FRAT1 expression is associated with the progression and poor prognosis of chondrosarcoma.
24829151 The mechanism of inhibiting beta-catenin phosphorylation involves the NDRG1-mediated upregulation of the GSK3beta-binding protein FRAT1.
23613813 These results highlight the potential role of FRAT1 in tumorigenesis and progression of glioblastoma.
22528942 The overexpression of Frat1 and beta-catenin was correlated with tumor differentiation, TNM stage, lymph node metastasis, and poor prognosis of NSCLC.
21818639 Down-regulation of Frat1 expression reduced invasive ability in A549 cell line, further supporting idea that Frat1 may play crucial role in carcinogenesis, tumor invasiveness and dissemination in human lung cancer.
20096670 Our results suggest that FRAT1 may be an important factor in the tumorigenesis and progression of gliomas, and could be used as a potential molecular marker for pathological diagnosis and a target for biological therapy.
20041315 Elevated expression of FRAT1 was associated with astrocytomas.
18498136 Aberrant activation of beta-catenin/TCF pathway in esophageal cancer appears to be due to upstream events such as FRAT1 overexpression, and c-Myc may be an important element in oncogenesis of human ESCC induced by FRAT1.
16982607 PKA phosphorylates FRAT1 in vitro as well as in intact cells and may play a role in regulating the inhibitory activity of FRAT1 toward GSK-3.
16479254 findings support that Wnt/beta-catenin signalling may be aberrantly activated through FRAT1 overexpression in ovarian serous adenocarcinomas
16385451 Observational study of gene-disease association. (HuGE Navigator)
12556519 CKI epsilon-dependent phosphorylation of Dvl enhances the formation of a complex of Dvl-1 with Frat-1 and this complex leads to the activation of Wnt-3a-induced accumulation of beta-catenin

AA Sequence

MPCRREEEEEAGEEAEGEEEEEDSFLLLQQSVALGSSGEVDRLVAQIGETLQLDAAQHSPASPCGPPGAP      1 - 70
LRAPGPLAAAVPADKARSPAVPLLLPPALAETVGPAPPGVLRCALGDRGRVRGRAAPYCVAELATGPSAL     71 - 140
SPLPPQADLDGPPGAGKQGIPQPLSGPCRRGWLRGAAASRRLQQRRGSQPETRTGDDDPHRLLQQLVLSG    141 - 210
NLIKEAVRRLHSRRLQLRAKLPQRPLLGPLSAPVHEPPSPRSPRAACSDPGASGRAQLRTGDGVLVPGS     211 - 279
//

Text Mined References (28)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26178481 2015 The clinical significance of FRAT1 and ABCG2 expression in pancreatic ductal adenocarcinoma.
25922553 2015 Overexpression of FRAT1 is associated with malignant phenotype and poor prognosis in human gliomas.
25387569 2015 The clinical pathological significance of FRAT1 and ROR2 expression in cartilage tumors.
24829151 2014 The metastasis suppressor NDRG1 modulates the phosphorylation and nuclear translocation of ?-catenin through mechanisms involving FRAT1 and PAK4.
23613813 2013 Knockdown of FRAT1 expression by RNA interference inhibits human glioblastoma cell growth, migration and invasion.
23602568 2013 The protein interaction landscape of the human CMGC kinase group.
23455922 2013 Interlaboratory reproducibility of large-scale human protein-complex analysis by standardized AP-MS.
22528942 2012 Expression of Frat1 correlates with expression of ?-catenin and is associated with a poor clinical outcome in human SCC and AC.
21818639 2011 Overexpression of Frat1 correlates with malignant phenotype and advanced stage in human non-small cell lung cancer.
20096670 2010 The expression profile of FRAT1 in human gliomas.
20041315 2011 FRAT1 expression and its correlation with pathologic grade, proliferation, and apoptosis in human astrocytomas.
19369195 2009 Large-scale proteomics analysis of the human kinome.
18498136 2008 FRAT1 overexpression leads to aberrant activation of beta-catenin/TCF pathway in esophageal squamous cell carcinoma.
16982607 2006 FRAT1, a substrate-specific regulator of glycogen synthase kinase-3 activity, is a cellular substrate of protein kinase A.
16479254 2006 Tissue microarray analysis of human FRAT1 expression and its correlation with the subcellular localisation of beta-catenin in ovarian tumours.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
12805274 2003 Identification of promoter regions in the human genome by using a retroviral plasmid library-based functional reporter gene assay.
12556519 2003 Casein kinase I epsilon enhances the binding of Dvl-1 to Frat-1 and is essential for Wnt-3a-induced accumulation of beta-catenin.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12095675 2002 Characterization and tissue-specific expression of human GSK-3-binding proteins FRAT1 and FRAT2.
11894125 2002 Molecular cloning and expression of proto-oncogene FRAT1 in human cancer.
11738041 2001 The structure of phosphorylated GSK-3beta complexed with a peptide, FRATtide, that inhibits beta-catenin phosphorylation.
11445844 2001 FRAT1 and FRAT2, clustered in human chromosome 10q24.1 region, are up-regulated in gastric cancer.
10428961 1999 Axin and Frat1 interact with dvl and GSK, bridging Dvl to GSK in Wnt-mediated regulation of LEF-1.
9034327 1997 Activation of a novel proto-oncogene, Frat1, contributes to progression of mouse T-cell lymphomas.