Property Summary

NCBI Gene PubMed Count 12
PubMed Score 3.47
PubTator Score 1.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7766 1.9e-06
adult high grade glioma 3701 1.3e-03
Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 0.7

Expression

  Differential Expression (2)

Disease log2 FC p
adult high grade glioma -1.100 1.3e-03
osteosarcoma -2.049 1.9e-06

Gene RIF (2)

AA Sequence

MHGHGGYDSDFSDDERCGESSKRKKRTVEDDLLLQKPFQKEKHGKVAHKQVAAELLDREEARNRRFHLIA      1 - 70
MDAYQRHTKFVNDYILYYGGKKEDFKRLGENDKTDLDVIRENHRFLWNEEDEMDMTWEKRLAKKYYDKLF     71 - 140
KEYCIADLSKYKENKFGFRWRVEKEVISGKGQFFCGNKYCDKKEGLKSWEVNFGYIEHGEKRNALVKLRL    141 - 210
CQECSIKLNFHHRRKEIKSKKRKDKTKKDCEESSHKKSRLSSAEEASKKKDKGHSSSKKSEDSLLRNSDE    211 - 280
EESASESELWKGPLPETDEKSQEEEFDEYFQDLFL                                       281 - 315
//

Text Mined References (17)

PMID Year Title