Property Summary

Ligand Count 1
NCBI Gene PubMed Count 23
PubMed Score 24.36
PubTator Score 33.25

Knowledge Summary

Patent (14,115)

Expression

  Differential Expression (22)

Disease log2 FC p
adrenocortical carcinoma -1.151 1.2e-02
adult high grade glioma 1.100 7.3e-03
Astrocytoma, Pilocytic 1.200 4.5e-04
atypical teratoid / rhabdoid tumor 1.400 6.3e-05
cutaneous lupus erythematosus 2.600 7.1e-04
glioblastoma 1.200 8.7e-04
head and neck cancer and chronic obstruc... 1.300 7.9e-03
inflammatory breast cancer 1.800 1.6e-03
interstitial cystitis 1.600 4.8e-04
intraductal papillary-mucinous adenoma (... -1.100 5.7e-03
invasive ductal carcinoma 1.036 1.5e-03
lung cancer -1.800 5.2e-05
lung carcinoma -2.300 3.6e-17
medulloblastoma 1.100 5.8e-03
medulloblastoma, large-cell 1.300 4.9e-05
nasopharyngeal carcinoma 1.200 1.7e-05
osteosarcoma 2.821 2.5e-03
ovarian cancer -1.500 1.0e-04
primary pancreatic ductal adenocarcinoma 1.007 1.2e-02
primitive neuroectodermal tumor 1.400 1.9e-02
tuberculosis -1.100 8.4e-05
ulcerative colitis 1.300 5.4e-04

Gene RIF (15)

AA Sequence

METNFSIPLNETEEVLPEPAGHTVLWIFSLLVHGVTFVFGVLGNGLVIWVAGFRMTRTVNTICYLNLALA      1 - 70
DFSFSAILPFRMVSVAMREKWPFGSFLCKLVHVMIDINLFVSVYLITIIALDRCICVLHPAWAQNHRTMS     71 - 140
LAKRVMTGLWIFTIVLTLPNFIFWTTISTTNGDTYCIFNFAFWGDTAVERLNVFITMAKVFLILHFIIGF    141 - 210
SVPMSIITVCYGIIAAKIHRNHMIKSSRPLRVFAAVVASFFICWFPYELIGILMAVWLKEMLLNGKYKII    211 - 280
LVLINPTSSLAFFNSCLNPILYVFMGRNFQERLIRSLPTSLERALTEVPDSAQTSNTDTTSASPPEETEL    281 - 350
QAM                                                                       351 - 353
//

Text Mined References (23)

PMID Year Title