Property Summary

NCBI Gene PubMed Count 113
PubMed Score 330.93
PubTator Score 221.02

Knowledge Summary

Patent (28,058)

TINX Plot

  Disease (4)

Expression

  Differential Expression (10)

Disease log2 FC p
colon cancer 1.500 2.3e-02
hepatocellular carcinoma 1.700 2.3e-04
lung adenocarcinoma -1.500 1.6e-10
lung cancer -2.600 4.7e-03
lung carcinoma -2.700 1.1e-16
mucosa-associated lymphoid tissue lympho... 2.169 1.0e-02
Multiple Sclerosis 1.200 9.9e-04
non-small cell lung cancer -1.622 1.5e-14
psoriasis 2.700 7.6e-39
ulcerative colitis 1.700 1.4e-02

 GWAS Trait (1)

Gene RIF (97)

AA Sequence

METNFSTPLNEYEEVSYESAGYTVLRILPLVVLGVTFVLGVLGNGLVIWVAGFRMTRTVTTICYLNLALA      1 - 70
DFSFTATLPFLIVSMAMGEKWPFGWFLCKLIHIVVDINLFGSVFLIGFIALDRCICVLHPVWAQNHRTVS     71 - 140
LAMKVIVGPWILALVLTLPVFLFLTTVTIPNGDTYCTFNFASWGGTPEERLKVAITMLTARGIIRFVIGF    141 - 210
SLPMSIVAICYGLIAAKIHKKGMIKSSRPLRVLTAVVASFFICWFPFQLVALLGTVWLKEMLFYGKYKII    211 - 280
DILVNPTSSLAFFNSCLNPMLYVFVGQDFRERLIHSLPTSLERALSEDSAPTNDTAANSASPPAETELQA    281 - 350
M//

Text Mined References (114)

PMID Year Title