Property Summary

NCBI Gene PubMed Count 100
PubMed Score 515.08
PubTator Score 2628.74

Knowledge Summary

Patent (21,372)

Expression

  Differential Expression (28)

MLP Assay (10)

AID Type Active / Inconclusive / Inactive Description
362 screening 61 / 0 / 4221 Formylpeptide Receptor Ligand Binding Assay
440 screening 181 / 24 / 24099 Primary HTS Assay for Formylpeptide Receptor (FPR) Ligands and Primary HTS Counter-Screen Assay for Formylpeptide-Like-1 (FPRL1) Ligands
519 confirmatory 24 / 0 / 248 Dose Response Assay for Formylpeptide Receptor (FPR) Ligands and Dose Response Counter-Screen Assay for Formylpeptide-Like-1 (FPRL1) Ligands
699 screening 16 / 0 / 18 Secondary Calcium Response Assay for Formylpeptide Receptor (FPR) Antagonists
722 screening 38 / 0 / 1238 Formylpeptide Receptor (FPR) Ligand Structure Activity Relationship (SAR) Analysis : Primary HTS Assay
724 confirmatory 15 / 0 / 43 Formylpeptide Receptor (FPR) Ligand Structure Activity Relationship (SAR) Analysis : Dose Response Assay
762 confirmatory 0 / 0 / 15 Formylpeptide Receptor (FPRL1) Ligand Structure Activity Relationship (SAR) Analysis : FPR Dose Response Counterscreen Assay
763 screening 1 / 0 / 169 Formylpeptide Receptor-Like-1 (FPRL1) Ligand Structure Activity Relationship (SAR) Analysis : FPR Primary HTS Assay Counterscreen
805 summary 15 / 0 / 0 Assay for Formylpeptide Receptor Family Ligands: Target Formylpeptide Receptor
863 other 9 / 0 / 6 Formylpeptide Receptor (FPR) Structure Activity Relationship (SAR) Analysis: Secondary Calcium Response Assay for Antagonists

Gene RIF (78)

PMID Text
26516201 these results highlight the importance of FPR1 in chemotherapy-induced anticancer immune responses.
26071379 a pepducin designed to target FPR1 was found to hijack FPR2 and potently inhibit neutrophil functions
25529763 The authors describe here the activation of isolated human blood neutrophils by TcdB and, moreover, by toxin fragments generated by limited proteolytical digestion via the FPR1 receptor.
25277308 FPR1 rs78488639 interacted with CFH rs800292, HTRA1 rs11200638, and smoking, enhancing risk to exudative age-related macular degeneration and polypoidal choroidal vasculopathy .
25263443 Data suggest that formyl peptide receptor 1 (FPR1) stimulation may represent a novel therapeutic approach to counteract tumor angiogenesis.
25201101 the co-upregulated expression of mast cell chymase and ANXA1-FPR1 system in ectopic endometrium suggests their involvement in the development of endometriotic lesions.
25109685 FAM19A4 is a novel ligand of formyl peptide receptor 1.
25031270 These results demonstrate that a necroptosis pathway, likely mediated by annexin 1 acting through the FPR1 receptor, contributes to Stevens-Johnson syndrome (SJS) and toxic epidermal necrolysis.
24778447 cross-desensitization of CCR1 by FPR1 was associated with CCR1 phosphorylation and moderate reduction of CCR1 cell-surface expression. In contrast, CCR2 was not phosphorylated or internalized after FPR1 activation.
24778024 FPR1 expression may be used as a novel indicator to predict outcome in gastric cancer patients after gastrectomy.
24466048 A low FPR1/beta1 integrin co-localization was observed.
23873933 Identification of C-terminal phosphorylation sites of N-formyl peptide receptor-1 (FPR1) in human blood neutrophils.
23562731 The active F2Pal10 pepducin also triggered a response in cells expressing a mutated FPR2 with the third intracellular loop identical to that of FPR1.
23373827 haplotypic variation in FPR1, especially the SNP p.V101L, alters the receptor's response to cyclosporins
23238745 UPAR, whose expression is regulated by uPA, can, in turn, regulate uPA expression through a mechanism involving its functional interaction with integrins and fMLF-Rs.
23185575 The expression of the formyl peptide receptor 1 (FPR1) gene in primary human macrophages is regulated by cytokines and bacterial ligands.
23147350 Our findings reveal that FPR and FPRL1 are overexpressed in primary melanoma and correlate with aggressive tumor characteristics
23012360 FPR1 is functionally expressed on human lens epithelial cells.
22768936 physiological shear forces alter neutrophil activation via FP
22174875 The expression of FPR1 in myeloid cells is developmentally regulated, and the differentiated cells are equipped for immediate response to microbial infections.
22094028 analysis of pyrazoles as novel FPR1 antagonists
22005393 Using the homology modeling of the receptors and the ligand docking simulation, here we show that these calpain inhibitors could bind to the putative N-formyl-Met-Leu-Phe (fMLF) binding site on FPR and/or FPRL1.
21921027 Enteric commensal bacteria induce extracellular signal-regulated kinase pathway signaling via formyl peptide receptor-dependent redox modulation of dual specific phosphatase 3
21372136 fMLP promotes osteoblast differentiation via the N-formyl peptide receptor 1-mediated signaling pathway in human mesenchymal stem cells from bone marrow
21254404 This study identifies annexin A1 as part of the anti-inflammatory pattern of apoptotic cells and links the activation of FPRs to established signalling pathways triggering anti-inflammatory responses.
21216225 This is the first study to evaluate polymorphisms of the FPR1 gene in stomach cancer to find a positive association between these polymorphisms and stomach cancer.
21144844 When normotensive individuals were compared to hypertensives ones, similar FPR1 C32T genotypes and allele frequency distributions were found
20930115 These observations suggest a novel signaling role for ANXA1 in mitogen-activated proliferation of breast tumor epithelial cells that is mediated via activation of FPR1 and FPR2.
20237496 Observational study of gene-disease association. (HuGE Navigator)
20197768 The expression of FPR is responsible for increased motility of human glioblastoma cells and their formation of highly invasive tumours.
20056178 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20019777 The presence of the C(+) genotype/allele C of FPR301 together with smoking conferred a higher risk for aggressive periodontitis.
20019777 Observational study of gene-disease association. (HuGE Navigator)
19892918 Observational study of gene-disease association. (HuGE Navigator)
19843937 Human natural killer (NK) cells express FPR1, and in turn the activation of the FPR1 receptor elicits cytolytic activity and chemotactic migration by interleukin-2 stimulated NK cells.
19722801 348T/T genotype is associated with significantly impaired PMN chemotaxis and an increased risk for developing AgP in African Americans. These associations do not seem to be related to significant reductions in FPR1 transcripts in subjects expressing 348T.
19722801 Observational study of gene-disease association. (HuGE Navigator)
19530962 The FPR1 single nucleotide polymorphism may be associated with E-selectin levels in the French population.
19530962 Observational study of gene-disease association. (HuGE Navigator)
19414538 Signals evoked via the FPR caused unidirectional down-regulation of CCR3-mediated chemotaxis but not respiratory burst in human eosinophils.
19254133 The frequency of synonymous SNP c.348T>C was significantly higher in African Americans with AgP than in controls. The 348T allele was significantly associated with AgP.
19254133 Observational study of gene-disease association. (HuGE Navigator)
19167353 SAA stimulates CCL2 production via FPRL1 and, thus, contributes to atherosclerosis.
19037090 increased methylation of p53 gene retains human glioblastoma cells at a more poorly differentiated phase associated with the aberrant expression of FPR as a tumor-promoting cell surface receptor.
18952127 The amino acid content in the N-terminal half of the cytoplasmic tail influences the structure and desensitization of FPR.
18253729 Formyl peptide receptor haplotypes do not appear to be associated with rheumatoid arthritis
18060741 The predominant activation of ERK1/2 through G protein may be a common characteristic among chemoattractant receptors.
18056353 Theses results support a novel role for FPR stimulation in enhancing intestinal epithelial cell restitution through PI3K-dependent activation of Rac1 and Cdc42.
17927965 Observational study of gene-disease association. (HuGE Navigator)
17927965 Polymorphonuclear neutrophils from subjects carrying the -12915T allele expressed significantly lower levels of FPR1 transcripts than those homozygous for the -12915C allele.
17692291 Piroxicam inhibits the neutrophil responses triggered through formyl peptide receptor, but not through formyl peptide receptor like 1 and this inhibition is due to a reduced binding of the activating ligand to its cell surface receptor.
17452560 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17442310 A new (patho)physiological role of FPR and its ligands in regulating MSC trafficking during induction of injured tissue repair.
17267694 the plasma membrane distributions of FPR and its cross-talk with IGE receptor
17234990 The N-formyl peptide receptors present in MSCs may play an important role in signaling stem cell adhesion, migration, and homing to injured and inflamed tissue for repair.
16953235 Observational study of gene-disease association. (HuGE Navigator)
16953235 data suggest an increased receptor activity and phenotypic expression of increased inflammatory indices in subjects with the FPR1 p.T11 allele
16675446 AnxA1 has a role in stimulating SKCO-15 cell migration through nFPR activation
16530386 A model with additional receptor state is sufficient to describe response data when two ligands (agonist/agonist or agonist/antagonist pairs) are added simultaneously, suggesting that cells respond to the accumulation of active receptors.
16253958 ERK/PLD2 pathway contributes to fMLP-mediated oxidant production
16114510 Three distinct segments of the formyl peptide receptor 1 (FPR1) mRNA of Man share probabilistically significant homologies with segments of the 18S rRNA which are highly conserved from Drosophila to Man.
16038804 FPR-mediated activation of ERK1/2 takes place primarily through G protein and is physiologically important to ensure transcriptional activation of myeloid immunomodulators, such as cytokines.
16002663 Activation of the formyl peptide receptor inhibits lipopolysaccharide-induced dendritic cell maturation.
15928303 FPR is expressed by highly malignant human glioma cells and appears to mediate motility, growth, and angiogenesis of human glioblastoma by interacting with host-derived agonists.
15866865 urokinase receptor-derived SRSRY peptide regulates cross-talk between fMLP and vitronectin receptors
15661400 endogenous formyl peptides, released by eukaryotic mitochondria from necrotic cells, induce chemotaxis using formyl peptide receptors expressed by thrombin-activated platelets
15625007 FPR and FPRL1, use distinct signaling pathways in activation of human neutrophils
15195697 FPR-F110S displayed a delayed and significantly reduced ERK phosphorylation whereas FPR-FSCW nearly lost the ability to phosphorylate ERK
15187149 an annexin 1 peptide can activate FPR, FPRL1, and FPRL2; results indicate that annexin 1 participates in regulating leukocyte emigration into inflamed tissue by activating and desensitizing different receptors of the FPR family.
12902510 Expression of FPRs on transformed or normal fibroblasts indicates that they are able to induce intracellular signaling events leading to fibroblast motility.
12595898 Observational study of gene-disease association. (HuGE Navigator)
12595898 Six single nucleotide polymorphisms have been identified including two located in the FPR1 second extracellular loop that are significantly associated with the periodontitis phenotype in African-American patients.
12565836 Critical role of N-terminal N-glycosylation for proper folding of the formyl peptide receptor.
12424254 phosphorylation domains differentially regulate arrestin and agonist affinity
12410796 investigated the direct effect of LXA4 as well as the effect on agonist-induced biological responses using transfected HL-60 cells expressing FPR, FPRL1 or FPRL2
11860029 A conformational study of human fMLP
11023526 Interaction of HIV-1 gp120 with CD4 is sufficient to trigger a marked reduction in C5a Receptor and a modest reduction in FMLP Receptor on monocytes
2541200 Interaction of HIV-1 gp120 with CD4 is sufficient to trigger a marked reduction in C5a Receptor and a modest reduction in FMLP Receptor on monocytes

AA Sequence

METNSSLPTNISGGTPAVSAGYLFLDIITYLVFAVTFVLGVLGNGLVIWVAGFRMTHTVTTISYLNLAVA      1 - 70
DFCFTSTLPFFMVRKAMGGHWPFGWFLCKFVFTIVDINLFGSVFLIALIALDRCVCVLHPVWTQNHRTVS     71 - 140
LAKKVIIGPWVMALLLTLPVIIRVTTVPGKTGTVACTFNFSPWTNDPKERINVAVAMLTVRGIIRFIIGF    141 - 210
SAPMSIVAVSYGLIATKIHKQGLIKSSRPLRVLSFVAAAFFLCWSPYQVVALIATVRIRELLQGMYKEIG    211 - 280
IAVDVTSALAFFNSCLNPMLYVFMGQDFRERLIHALPASLERALTEDSTQTSDTATNSTLPSAEVELQAK    281 - 350
//

Text Mined References (101)

PMID Year Title
26516201 2015 Chemotherapy-induced antitumor immunity requires formyl peptide receptor 1.
26071379 2015 A neutrophil inhibitory pepducin derived from FPR1 expected to target FPR1 signaling hijacks the closely related FPR2 instead.
25529763 2015 Human neutrophils are activated by a peptide fragment of Clostridium difficile toxin B presumably via formyl peptide receptor.
25277308 2014 FPR1 interacts with CFH, HTRA1 and smoking in exudative age-related macular degeneration and polypoidal choroidal vasculopathy.
25263443 2015 The formyl peptide receptor 1 exerts a tumor suppressor function in human gastric cancer by inhibiting angiogenesis.
25201101 2015 The intricate role of mast cell proteases and the annexin A1-FPR1 system in abdominal wall endometriosis.
25109685 2015 FAM19A4 is a novel cytokine ligand of formyl peptide receptor 1 (FPR1) and is able to promote the migration and phagocytosis of macrophages.
25031270 2014 An annexin A1-FPR1 interaction contributes to necroptosis of keratinocytes in severe cutaneous adverse drug reactions.
24778447 2014 Cross-desensitization of CCR1, but not CCR2, following activation of the formyl peptide receptor FPR1.
24778024 2014 Formyl Peptide receptor 1 expression is associated with tumor progression and survival in gastric cancer.
24466048 2014 The urokinase receptor takes control of cell migration by recruiting integrins and FPR1 on the cell surface.
23873933 2013 Identification of C-terminal phosphorylation sites of N-formyl peptide receptor-1 (FPR1) in human blood neutrophils.
23562731 2013 The leukocyte chemotactic receptor FPR2, but not the closely related FPR1, is sensitive to cell-penetrating pepducins with amino acid sequences descending from the third intracellular receptor loop.
23373827 2013 V101L of human formyl peptide receptor 1 (FPR1) increases receptor affinity and augments the antagonism mediated by cyclosporins.
23238745 2013 uPAR regulates pericellular proteolysis through a mechanism involving integrins and fMLF-receptors.
23185575 2012 Regulation of the formyl peptide receptor 1 (FPR1) gene in primary human macrophages.
23147350 2013 Differential expression of the G-protein-coupled formyl Peptide receptor in melanoma associates with aggressive phenotype.
23012360 2012 The leukocyte chemotactic receptor FPR1 is functionally expressed on human lens epithelial cells.
22859307 2012 Formyl peptide receptors from immune and vomeronasal system exhibit distinct agonist properties.
22768936 2012 Shear-induced resistance to neutrophil activation via the formyl peptide receptor.
22447027 2012 Bidirectional regulation of neutrophil migration by mitogen-activated protein kinases.
22174875 2011 Regulation of human formyl peptide receptor 1 synthesis: role of single nucleotide polymorphisms, transcription factors, and inflammatory mediators.
22094028 2012 Lead optimisation of pyrazoles as novel FPR1 antagonists.
22005393 2011 Stimulation of human formyl peptide receptors by calpain inhibitors: homology modeling of receptors and ligand docking simulation.
21921027 2011 Enteric commensal bacteria induce extracellular signal-regulated kinase pathway signaling via formyl peptide receptor-dependent redox modulation of dual specific phosphatase 3.
21372136 2011 N-formyl-methionyl-leucyl-phenylalanine (fMLP) promotes osteoblast differentiation via the N-formyl peptide receptor 1-mediated signaling pathway in human mesenchymal stem cells from bone marrow.
21254404 2011 Annexin A1 released from apoptotic cells acts through formyl peptide receptors to dampen inflammatory monocyte activation via JAK/STAT/SOCS signalling.
21216225 2011 Polymorphisms of the formylpeptide receptor gene (FPR1) and susceptibility to stomach cancer in 1531 consecutive autopsy cases.
21144844 2012 Human formyl peptide receptor 1 C32T SNP interacts with age and is associated with blood pressure levels.
20930115 2011 Annexin-1 signals mitogen-stimulated breast tumor cell proliferation by activation of the formyl peptide receptors (FPRs) 1 and 2.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20197768 2010 The G-protein-coupled formylpeptide receptor FPR confers a more invasive phenotype on human glioblastoma cells.
20056178 2010 Polymorphisms in innate immunity genes and patients response to dendritic cell-based HIV immuno-treatment.
20019777 2009 [Association of SNPs in N-formylpeptide receptor gene with susceptibility of aggressive periodontitis].
19892918 2009 Genetic risk factors for periodontitis in a Japanese population.
19843937 2009 Functional expression of formyl peptide receptor family in human NK cells.
19722801 2009 Formylpeptide receptor single nucleotide polymorphism 348T>C and its relationship to polymorphonuclear leukocyte chemotaxis in aggressive periodontitis.
19530962 2009 Human formyl peptide receptor 1 (FPR1) c.32C>T SNP is associated with decreased soluble E-selectin levels.
19414538 2009 Interplay between signaling via the formyl peptide receptor (FPR) and chemokine receptor 3 (CCR3) in human eosinophils.
19254133 2009 Neutrophil formylpeptide receptor single nucleotide polymorphism 348T>C in aggressive periodontitis.
19167353 2009 Activation of formyl peptide receptor like-1 by serum amyloid A induces CCL2 production in human umbilical vein endothelial cells.
19037090 2009 Regulation of the leucocyte chemoattractant receptor FPR in glioblastoma cells by cell differentiation.
18952127 2009 Agonist-dependent phosphorylation of the formyl peptide receptor is regulated by the membrane proximal region of the cytoplasmic tail.
18577758 2008 Dissociation of heterotrimeric g proteins in cells.
18253729 2008 Variable responses of formyl peptide receptor haplotypes toward bacterial peptides.
18060741 2008 Formyl peptide receptor-mediated ERK1/2 activation occurs through G(i) and is not dependent on beta-arrestin1/2.
18056353 2007 Formyl peptide receptor-1 activation enhances intestinal epithelial cell restitution through phosphatidylinositol 3-kinase-dependent activation of Rac1 and Cdc42.
17927965 2007 Functional polymorphisms of the FPR1 gene and aggressive periodontitis in Japanese.
17692291 2007 The non-steroidal anti-inflammatory drug piroxicam blocks ligand binding to the formyl peptide receptor but not the formyl peptide receptor like 1.
17452560 2007 Gene polymorphisms and the prevalence of key periodontal pathogens.
17442310 2007 Expression and functional role of formyl peptide receptor in human bone marrow-derived mesenchymal stem cells.
17267694 2007 Activated N-formyl peptide receptor and high-affinity IgE receptor occupy common domains for signaling and internalization.
17234990 2007 Functional expression of N-formyl peptide receptors in human bone marrow-derived mesenchymal stem cells.
16953235 2007 Analysis of a missense variant of the human N-formyl peptide receptor that is associated with agonist-independent beta-arrestin association and indices of inflammation.
16675446 2006 Annexin I regulates SKCO-15 cell invasion by signaling through formyl peptide receptors.
16530386 2006 Multiple receptor states are required to describe both kinetic binding and activation of neutrophils via N-formyl peptide receptor ligands.
16253958 2006 A role of p44/42 mitogen-activated protein kinases in formyl-peptide receptor-mediated phospholipase D activity and oxidant production.
16114510 2005 Structural similarities between mRNA for the formyl peptide receptors and 18S rRNA.
16038804 2005 Activation and nuclear translocation of ERK1/2 by the formyl peptide receptor is regulated by G protein and is not dependent on beta-arrestin translocation or receptor endocytosis.
16002663 2005 The synthetic peptide Trp-Lys-Tyr-Met-Val-D-Met inhibits human monocyte-derived dendritic cell maturation via formyl peptide receptor and formyl peptide receptor-like 2.
15928303 2005 Formylpeptide receptor FPR and the rapid growth of malignant human gliomas.
15866865 2005 Cross-talk between fMLP and vitronectin receptors triggered by urokinase receptor-derived SRSRY peptide.
15661400 2005 Human platelets exhibit chemotaxis using functional N-formyl peptide receptors.
15625007 2004 The two neutrophil members of the formylpeptide receptor family activate the NADPH-oxidase through signals that differ in sensitivity to a gelsolin derived phosphoinositide-binding peptide.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15258259 2004 Silencing the formylpeptide receptor FPR by short-interfering RNA.
15195697 2004 Normal cell surface expression and selective loss of functions resulting from Phe110 to Ser and Cys126 to Trp substitutions in the formyl peptide receptor.
15187149 2004 An annexin 1 N-terminal peptide activates leukocytes by triggering different members of the formyl peptide receptor family.
15153520 2004 Chemotaxis inhibitory protein of Staphylococcus aureus binds specifically to the C5a and formylated peptide receptor.
15057824 2004 The DNA sequence and biology of human chromosome 19.
12902510 2003 Expression and function of formyl peptide receptors on human fibroblast cells.
12595898 2003 Evaluation of human leukocyte N-formylpeptide receptor (FPR1) SNPs in aggressive periodontitis patients.
12565836 2003 Critical role of N-terminal N-glycosylation for proper folding of the human formyl peptide receptor.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12424254 2003 N-formyl peptide receptor phosphorylation domains differentially regulate arrestin and agonist affinity.
12410796 2002 Phagocyte activation by Trp-Lys-Tyr-Met-Val-Met, acting through FPRL1/LXA4R, is not affected by lipoxin A4.
12218158 2002 Identification, cloning, and functional characterization of a murine lipoxin A4 receptor homologue gene.
11559706 2001 Defective Gi protein coupling in two formyl peptide receptor mutants associated with localized juvenile periodontitis.
10889468 2000 Studies on fMLP-receptor interaction and signal transduction pathway by means of fMLP-OMe selective analogues.
10882119 2000 A novel ligand of the formyl peptide receptor: annexin I regulates neutrophil extravasation by interacting with the FPR.
10861041 2000 Rebound from nitric oxide inhibition triggers enhanced monocyte activation and chemotaxis.
10857861 2000 Serum-induced monocyte differentiation and monocyte chemotaxis are regulated by the p38 MAP kinase signal transduction pathway.
10823817 2000 Arrestin binding to the G protein-coupled N-formyl peptide receptor is regulated by the conserved "DRY" sequence.
10820279 2000 Differential ability of exogenous chemotactic agents to disrupt transendothelial migration of flowing neutrophils.
10753626 2000 Serum amyloid A is a chemotactic agonist at FPR2, a low-affinity N-formylpeptide receptor on mouse neutrophils.
10514456 1999 Differential phosphorylation paradigms dictate desensitization and internalization of the N-formyl peptide receptor.
8663057 1996 Direct or C5a-induced activation of heterotrimeric Gi2 proteins in human neutrophils is associated with interaction between formyl peptide receptors and the cytoskeleton.
8228254 1993 Functional molecular complexes of human N-formyl chemoattractant receptors and actin.
8224916 1993 Sequence and organization of the human N-formyl peptide receptor-encoding gene.
7947984 1994 Characterization of complex formation between Gi2 and octyl glucoside solubilized neutrophil N-formyl peptide chemoattractant receptor by sedimentation velocity.
7945424 1994 Physical coupling of N-formyl peptide chemoattractant receptors to G protein is unaffected by desensitization.
7836371 1995 Phosphorylation of the N-formyl peptide receptor carboxyl terminus by the G protein-coupled receptor kinase, GRK2.
6129903 1982 Intracellular localization of N-formyl chemotactic receptor and Mg2+ dependent ATPase in human granulocytes.
2834384 1988 Presence of three distinct molecular species of Gi protein alpha subunit. Structure of rat cDNAs and human genomic DNAs.
2176894 1990 The human N-formylpeptide receptor. Characterization of two cDNA isolates and evidence for a new subfamily of G-protein-coupled receptors.
2161213 1990 Synthesis and use of a novel N-formyl peptide derivative to isolate a human N-formyl peptide receptor cDNA.
1712023 1991 Functional expression of the human formyl peptide receptor in Xenopus oocytes requires a complementary human factor.
1612600 1992 Mapping of genes for the human C5a receptor (C5AR), human FMLP receptor (FPR), and two FMLP receptor homologue orphan receptors (FPRH1, FPRH2) to chromosome 19.
1445895 1992 Cloning of the gene coding for a human receptor for formyl peptides. Characterization of a promoter region and evidence for polymorphic expression.
1373134 1992 A structural homologue of the N-formyl peptide receptor. Characterization and chromosome mapping of a peptide chemoattractant receptor family.
1322204 1992 Simultaneous mobilization of Mac-1 (CD11b/CD18) and formyl peptide chemoattractant receptors in human neutrophils.