Property Summary

Ligand Count 18
NCBI Gene PubMed Count 106
PubMed Score 255.15
PubTator Score 2628.74

Knowledge Summary

Patent (21,372)

Expression

  Differential Expression (28)

Gene RIF (84)

AA Sequence

METNSSLPTNISGGTPAVSAGYLFLDIITYLVFAVTFVLGVLGNGLVIWVAGFRMTHTVTTISYLNLAVA      1 - 70
DFCFTSTLPFFMVRKAMGGHWPFGWFLCKFVFTIVDINLFGSVFLIALIALDRCVCVLHPVWTQNHRTVS     71 - 140
LAKKVIIGPWVMALLLTLPVIIRVTTVPGKTGTVACTFNFSPWTNDPKERINVAVAMLTVRGIIRFIIGF    141 - 210
SAPMSIVAVSYGLIATKIHKQGLIKSSRPLRVLSFVAAAFFLCWSPYQVVALIATVRIRELLQGMYKEIG    211 - 280
IAVDVTSALAFFNSCLNPMLYVFMGQDFRERLIHALPASLERALTEDSTQTSDTATNSTLPSAEVELQAK    281 - 350
//

Text Mined References (107)

PMID Year Title