Property Summary

NCBI Gene PubMed Count 56
PubMed Score 80.94
PubTator Score 197.52

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.200 3.7e-09
glioblastoma 1.200 1.9e-05
medulloblastoma, large-cell 1.300 4.9e-05

 IMPC Phenotype (1)

Gene RIF (41)

PMID Text
26895662 data suggest that FPGS modulation affects global and promoter CpG DNA methylation and expression of several genes involved in important biological pathways
26751406 529 adults (n = 325 European-Americans, 204 Egyptians) on a stable warfarin dose were genotyped for GGCX rs12714145 and rs10654848, FPGS rs7856096, and STX1B rs4889606.
26676887 the highest expression of GGH and EGFR was noted in the left-sided colon; the highest expression of DHFR, FPGS, TOP1 and ERCC1 was noted in the rectosigmoid, whereas TYMP expression was approximately equivalent in the right-sided colon and rectum
26652611 FPGS and ABCB1 genetic variants can influence the outcome in RA patients receiving MTX monotherapy.
26107232 Genetic polymorphisms in the FPGS coding region are significantly associated with increased Acute Lymphoblastic Leukemia risk.
25765001 study found that genetic polymorphism of FPGS rs10760502A > G is associated with susceptibility to primary retroperitoneal liposasrcoma
25229333 antifolate resistant leukemia cells harbor a heterozygous point mutation in exon12 of FPGS which disrupts FPGS activity by abolishing ATP binding, and alters the binding pattern of transcription factors to the genomic region of exon12.
25164808 mitochondrial FPGS is required because folate polyglutamates are not substrates for transport across the mitochondrial membrane
24908438 Polymorphism of FPGS rs1544105 G>A is associated with response to therapy in acute lymphoblastic leukemia.
24583629 Genome-wide association studies identify 10 novel genetic loci as risk factors for methotrexate response in rheumatoid arthritis patients additionally to polymorphism in DHFR, FPGS and TYMS.
24447348 An interaction term, between FPGS rs7033913 heterozygotes and GGH rs11988534 homozygotes for the minor allele, had a p-value <0.0001 and may contribute to methotrexate toxicity in rheumatoid arthritis.
22895141 High Folylpoly-glutamate synthetase expression is associated with response to therapy in non-small-cell lung cancer.
22809608 A novel missense mutation 502/490 T>C (L151/101P) in exon 5 of FPGS gene is firstly found in Chinese Han children, and the cytosolic and mitochondrial variants display allelic frequencies of 0.70 % and 0.47 % respectively.
22698741 The mbr enhanced the expression of FPGS significantly and increased sensitivity of Jurkat cells to MTX efficiently.
22018726 This is one of the first studies to assess FPGS and GGH genetic variants in relation to plasma homocysteine.
21418912 The expression of mFPGS was different in A549 cells exposed to different methotrexate enantiomers.
21380490 intratumor FPGS plays an important role in the efficacy of oral fluoropyrimidine plus LV therapy for colorectal cancer.
21093159 FPGS gene is proposed as a novel causative gene for cleft lip.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20651609 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20453000 Observational study of gene-disease association. (HuGE Navigator)
20037791 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19841321 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19636555 Data revealed that high FPGS gene expression, low GGH gene expression and low ABCC1 gene expression in CRC tissues were predictive factors for a high reduced folate level after LV administration.
19161160 Observational study of gene-disease association. (HuGE Navigator)
19131550 Aberrant splicing of folylpolyglutamate synthetase is associated with antifolate resistance in leukemia.
19093297 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19016697 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18854154 Knockdown of folylpolyglutamate synthase (FPGS) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
18842806 Observational study of gene-disease association. (HuGE Navigator)
18830263 Observational study of gene-disease association. (HuGE Navigator)
18672898 Results indicate that hFPGS can catalyze the processive addition of approximately four glutamate residues to DDAH 4PteGlu 1.
18381794 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17891500 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
17875718 study identified FPGS polymorphisms; results indicate that two of the cytosolic nonsynonymous coding SNPs affected protein expression, in vitro substrate kinetics & folate & antifolate efficacy in cells expressing the polymorphisms
17286537 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17119116 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16707018 Investigation of the molecular regulatory mechanisms directing FPGS gene expression in B precursor-ALL and T-ALL cells.
16169100 human mitochondrial FPGS is at least in part strongly associated with the inner mitochondrial membrane
16122883 Significantly higher expression levels of FPGS were found in mucosa expressing the splice variant DCC342.
14676127 low folylpolyglutamate synthase expression is associated with development of aggressive metastatic behavior of the colorectal cancer

AA Sequence

MSRARSHLRAALFLAAASARGITTQVAARRGLSAWPVPQEPSMEYQDAVRMLNTLQTNAGYLEQVKRQRG      1 - 70
DPQTQLEAMELYLARSGLQVEDLDRLNIIHVTGTKGKGSTCAFTECILRSYGLKTGFFSSPHLVQVRERI     71 - 140
RINGQPISPELFTKYFWRLYHRLEETKDGSCVSMPPYFRFLTLMAFHVFLQEKVDLAVVEVGIGGAYDCT    141 - 210
NIIRKPVVCGVSSLGIDHTSLLGDTVEKIAWQKGGIFKQGVPAFTVLQPEGPLAVLRDRAQQISCPLYLC    211 - 280
PMLEALEEGGPPLTLGLEGEHQRSNAALALQLAHCWLQRQDRHGAGEPKASRPGLLWQLPLAPVFQPTSH    281 - 350
MRLGLRNTEWPGRTQVLRRGPLTWYLDGAHTASSAQACVRWFRQALQGRERPSGGPEVRVLLFNATGDRD    351 - 420
PAALLKLLQPCQFDYAVFCPNLTEVSSTGNADQQNFTVTLDQVLLRCLEHQQHWNHLDEEQASPDLWSAP    421 - 490
SPEPGGSASLLLAPHPPHTCSASSLVFSCISHALQWISQGRDPIFQPPSPPKGLLTHPVAHSGASILREA    491 - 560
AAIHVLVTGSLHLVGGVLKLLEPALSQ                                               561 - 587
//

Text Mined References (64)

PMID Year Title
26895662 2016 Effects of folylpolyglutamate synthase modulation on global and gene-specific DNA methylation and gene expression in human colon and breast cancer cells.
26751406 2016 Impact of GGCX, STX1B and FPGS Polymorphisms on Warfarin Dose Requirements in European-Americans and Egyptians.
26676887 2016 Association between mRNA expression of chemotherapy-related genes and clinicopathological features in colorectal cancer: A large-scale population analysis.
26652611 2016 Methotrexate pharmacokinetic genetic variants are associated with outcome in rheumatoid arthritis patients.
26107232 2015 Mutation Screening and Association Study of the Folylpolyglutamate Synthetase (FPGS) Gene with Susceptibility to Childhood Acute Lymphoblastic Leukemia.
25765001 2015 Association of FPGS genetic polymorphisms with primary retroperitoneal liposarcoma.
25229333 2014 Binding of a Smad4/Ets-1 complex to a novel intragenic regulatory element in exon12 of FPGS underlies decreased gene expression and antifolate resistance in leukemia.
25164808 2014 Mammalian mitochondrial and cytosolic folylpolyglutamate synthetase maintain the subcellular compartmentalization of folates.
24908438 2014 Influence of genetic polymorphisms of FPGS, GGH, and MTHFR on serum methotrexate levels in Chinese children with acute lymphoblastic leukemia.
24583629 2014 Genome-wide analysis of methotrexate pharmacogenomics in rheumatoid arthritis shows multiple novel risk variants and leads for TYMS regulation.
24447348 Folic acid pathway single nucleotide polymorphisms associated with methotrexate significant adverse events in United States veterans with rheumatoid arthritis.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22895141 2012 Folylpoly-glutamate synthetase expression is associated with tumor response and outcome from pemetrexed-based chemotherapy in malignant pleural mesothelioma.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22809608 2012 [A novel missense mutation of folypolyglutamate synthetase gene].
22698741 2012 [The mbr-FPGS efficient expression plasmid enhances the sensitivity of Jurkat cells to methotrexate].
22018726 2012 Genetic variation in folylpolyglutamate synthase and gamma-glutamyl hydrolase and plasma homocysteine levels in the Singapore Chinese Health Study.
21418912 2011 [Differential gene expression of folylpolyglutamate synthetase in cytoplasm and mitochondria in acquired methotrexate enantiomers resistant to lung cancer A549 cell lines].
21380490 2011 In vivo evidence for a significant role of folylpolyglutamate synthase in combined chemotherapy with oral fluoropyrimidine, UFT or S-1, and leucovorin.
21093159 2011 FPGS gene is a novel causative gene for cleft lip in China.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20651609 2010 Correlation between polymorphisms of the reduced folate carrier gene (SLC19A1) and survival after pemetrexed-based therapy in non-small cell lung cancer: a North Central Cancer Treatment Group-based exploratory study.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
20037791 2010 Genes involved with folate uptake and distribution and their association with colorectal cancer risk.
19841321 2010 Phase II trial of pemetrexed plus bevacizumab for second-line therapy of patients with advanced non-small-cell lung cancer: NCCTG and SWOG study N0426.
19636555 2010 Molecular determinants of folate levels after leucovorin administration in colorectal cancer.
19161160 2009 An association study of 45 folate-related genes in spina bifida: Involvement of cubilin (CUBN) and tRNA aspartic acid methyltransferase 1 (TRDMT1).
19131550 2009 Aberrant splicing of folylpolyglutamate synthetase as a novel mechanism of antifolate resistance in leukemia.
19093297 2008 Interaction of genes from influx-metabolism-efflux pathway and their influence on methotrexate efficacy in rheumatoid arthritis patients among Indians.
19016697 2009 Outcomes of methotrexate therapy for psoriasis and relationship to genetic polymorphisms.
18842806 2008 Associations between single nucleotide polymorphisms in folate uptake and metabolizing genes with blood folate, homocysteine, and DNA uracil concentrations.
18830263 2009 Polymorphisms in DNA repair and one-carbon metabolism genes and overall survival in diffuse large B-cell lymphoma and follicular lymphoma.
18672898 2008 Concentration-dependent processivity of multiple glutamate ligations catalyzed by folylpoly-gamma-glutamate synthetase.
18381794 2008 Methotrexate (MTX) pathway gene polymorphisms and their effects on MTX toxicity in Caucasian and African American patients with rheumatoid arthritis.
17891500 2007 One-carbon metabolism gene polymorphisms and risk of non-Hodgkin lymphoma in Australia.
17875718 2007 Identification and characterization of genetic variation in the folylpolyglutamate synthase gene.
17286537 2007 Exploratory analysis of four polymorphisms in human GGH and FPGS genes and their effect in methotrexate-treated rheumatoid arthritis patients.
17119116 2007 Gene-nutrient interactions among determinants of folate and one-carbon metabolism on the risk of non-Hodgkin lymphoma: NCI-SEER case-control study.
16707018 2006 Analysis of folylpoly-gamma-glutamate synthetase gene expression in human B-precursor ALL and T-lineage ALL cells.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16169100 2005 Submitochondrial localization of the mitochondrial isoform of folylpolyglutamate synthetase in CCRF-CEM human T-lymphoblastic leukemia cells.
16122883 2005 Low expression of reduced folate carrier-1 and folylpolyglutamate synthase correlates with lack of a deleted in colorectal carcinoma mRNA splice variant in normal-appearing mucosa of colorectal carcinoma patients.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14676127 2003 Altered gene expression of folate enzymes in adjacent mucosa is associated with outcome of colorectal cancer patients.
12663051 2003 Decreased expression of the reduced folate carrier and folypolyglutamate synthetase is the basis for acquired resistance to the pemetrexed antifolate (LY231514) in an L1210 murine leukemia cell line.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11309345 2001 Folylpoly-gamma-glutamate synthetase gene mRNA splice variants and protein expression in primary human leukemia cells, cell lines, and normal human tissues.
10964921 2000 Expression patterns of the multiple transcripts from the folylpolyglutamate synthetase gene in human leukemias and normal differentiated tissues.
10777604 2000 Human cytosolic and mitochondrial folylpolyglutamate synthetase are electrophoretically distinct. Expression in antifolate-sensitive and -resistant human cell lines.
9312158 1997 Transcription of the human folylpoly-gamma-glutamate synthetase gene.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8662720 1996 Purification and properties of human cytosolic folylpoly-gamma-glutamate synthetase and organization, localization, and differential splicing of its gene.
8521387 1995 Structural organization of the human folypoly-gamma-glutamate synthetase gene: evidence for a single genomic locus.
8408021 1993 Regulation of folate and one-carbon metabolism in mammalian cells. IV. Role of folylpoly-gamma-glutamate synthetase in methotrexate metabolism and cytotoxicity.
8408020 1993 Regulation of folate and one-carbon metabolism in mammalian cells. III. Role of mitochondrial folylpoly-gamma-glutamate synthetase.
8408019 1993 Regulation of folate and one-carbon metabolism in mammalian cells. II. Effect of folylpoly-gamma-glutamate synthetase substrate specificity and level on folate metabolism and folylpoly-gamma-glutamate specificity of metabolic cycles of one-carbon metabolism.
8408018 1993 Regulation of folate and one-carbon metabolism in mammalian cells. I. Folate metabolism in Chinese hamster ovary cells expressing Escherichia coli or human folylpoly-gamma-glutamate synthetase activity.
7721888 1995 Upstream organization of and multiple transcripts from the human folylpoly-gamma-glutamate synthetase gene.
6934068 1980 Chromosomal assignment of the gene for folylpolyglutamate synthetase to human chromosome 9.
3828320 1987 Mammalian folylpoly-gamma-glutamate synthetase. 1. Purification and general properties of the hog liver enzyme.
3619447 1987 Human liver folylpolyglutamate synthetase: biochemical characterization and interactions with folates and folate antagonists.
1409616 1992 Expression cloning of a human cDNA encoding folylpoly(gamma-glutamate) synthetase and determination of its primary structure.