Property Summary

NCBI Gene PubMed Count 5
PubMed Score 4.94
PubTator Score 4.32

Knowledge Summary


No data available


  Disease (2)

Disease Target Count
Nerve Sheath Tumors 5
Disease Target Count Z-score Confidence
medulloblastoma 1524 3.048 1.5

Gene RIF (1)

15202009 Human FOXN6 gene was identified within human genome sequence RP11-167P23 (

AA Sequence

WEETRVLAFAQRERIQECMSQPELLTSLFDL                                           281 - 311

Text Mined References (5)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15202027 2004 Identification and characterization of human FOXK1 gene in silico.
15202009 2004 Identification and characterization of human FOXN6, mouse Foxn6, and rat Foxn6 genes in silico.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.