Property Summary

NCBI Gene PubMed Count 24
PubMed Score 12.73
PubTator Score 10.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (2)

Disease log2 FC p
group 4 medulloblastoma -1.300 9.4e-05
lung carcinoma 1.800 1.0e-31

Gene RIF (14)

PMID Text
26642711 rs4714476 at the 5' near gene of FOXP4 potentially contributes to the susceptibility of prostate cancer in Chinese men
26537068 association of the THADA, FOXP4, GPRC6A/RFX6 and 8q24 genes with prostate cancer in Asian populations.
26484395 FOXP4 and SHROOM1 genes are hypermethylated in the knee osteoarthritic cartilage.
25994569 High FOXP4 expression is associated with non-small cell lung cancer.
25755720 These findings suggest that miR-338-3p regulates survival of hepatocellular carcinoma cells partially through the downregulation of FOXP4
25472883 HIV-1 Tat specifically associates with FOXP4 promoter to upregulate FOXP4 expression in T cells
22912696 Foxp4 is dispensable for T cell development, but necessary for normal T cell cytokine recall responses to antigen following pathogenic infection
22662242 Our results provide further support for association of the C2orf43, FOXP4, GPRC6A and RFX6 genes with prostate cancer in Eastern Asian populations
20676098 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
18322169 Contrary to the current view, T cell receptor-mediated signals are not responsible for the induction of FOXP3 in human thymocytes.
16952980 these data implicate specific members of the FOX family of TFs (FOXC1, C2, P1, P4, and O1A) not previously suggested in heart failure pathogenesis.

AA Sequence

MMVESASETIRSAPSGQNGVGSLSGQADGSSGGATGTTASGTGREVTTGADSNGEMSPAELLHFQQQQAL      1 - 70
QVARQFLLQQASGLSSPGNNDSKQSASAVQVPVSVAMMSPQMLTPQQMQQILSPPQLQALLQQQQALMLQ     71 - 140
QLQEYYKKQQEQLHLQLLTQQQAGKPQPKEALGNKQLAFQQQLLQMQQLQQQHLLNLQRQGLVSLQPNQA    141 - 210
SGPLQTLPQAAVCPTDLPQLWKGEGAPGQPAEDSVKQEGLDLTGTAATATSFAAPPKVSPPLSHHTLPNG    211 - 280
QPTVLTSRRDSSSHEETPGSHPLYGHGECKWPGCETLCEDLGQFIKHLNTEHALDDRSTAQCRVQMQVVQ    281 - 350
QLEIQLAKESERLQAMMAHLHMRPSEPKPFSQPLNPVPGSSSFSKVTVSAADSFPDGLVHPPTSAAAPVT    351 - 420
PLRPPGLGSASLHGGGPARRRSSDKFCSPISSELAQNHEFYKNADVRPPFTYASLIRQAILETPDRQLTL    421 - 490
NEIYNWFTRMFAYFRRNTATWKNAVRHNLSLHKCFVRVENVKGAVWTVDEREYQKRRPPKMTGSPTLVKN    491 - 560
MISGLSYGALNASYQAALAESSFPLLNSPGMLNPGSASSLLPLSHDDVGAPVEPLPSNGSSSPPRLSPPQ    561 - 630
YSHQVQVKEEPAEAEEDRQPGPPLGAPNPSASGPPEDRDLEEELPGEELS                        631 - 680
//

Text Mined References (32)

PMID Year Title
26642711 2015 Association of FOXP4 Gene with Prostate Cancer and the Cumulative Effects of rs4714476 and 8q24 in Chinese Men.
26537068 Association of THADA, FOXP4, GPRC6A/RFX6 genes and 8q24 risk alleles with prostate cancer in Northern Chinese men.
26484395 2016 Identification of differentially methylated regions in new genes associated with knee osteoarthritis.
25994569 2015 FOXP4 modulates tumor growth and independently associates with miR-138 in non-small cell lung cancer cells.
25755720 2015 MicroRNA-338-3p inhibits cell proliferation in hepatocellular carcinoma by target forkhead box P4 (FOXP4).
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25027557 2015 Transcriptional regulation by FOXP1, FOXP2, and FOXP4 dimerization.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22912696 2012 Foxp4 is dispensable for T cell development, but required for robust recall responses.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22662242 2012 Replication and fine mapping for association of the C2orf43, FOXP4, GPRC6A and RFX6 genes with prostate cancer in the Chinese population.
20676098 2010 Genome-wide association study identifies five new susceptibility loci for prostate cancer in the Japanese population.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18322169 2008 Cutting edge: human CD4-CD8- thymocytes express FOXP3 in the absence of a TCR.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17567994 2007 Prominent use of distal 5' transcription start sites and discovery of a large number of additional exons in ENCODE regions.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16952980 2006 Transcriptional genomics associates FOX transcription factors with human heart failure.
15492844 2004 Human FOX gene family (Review).
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14701752 2004 Transcriptional and DNA binding activity of the Foxp1/2/4 family is modulated by heterotypic and homotypic protein interactions.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
14516685 2002 Foxp4: a novel member of the Foxp subfamily of winged-helix genes co-expressed with Foxp1 and Foxp2 in pulmonary and gut tissues.
12818433 2003 FoxP4, a novel forkhead transcription factor.
12617805 2002 Foxp4: a novel member of the Foxp subfamily of winged-helix genes co-expressed with Foxp1 and Foxp2 in pulmonary and gut tissues.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.