Property Summary

NCBI Gene PubMed Count 119
PubMed Score 190.86
PubTator Score 286.13

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Acquired metabolic disease 267 0.0 1.0
Vitiligo 71 0.0 1.0
Disease Target Count Z-score Confidence
Intellectual disability 573 0.0 4.0
Disease Target Count Z-score Confidence
Cancer 2346 4.175 2.1
Speech disorder 7 3.073 1.5

Expression

 GO Component (2)

Gene RIF (97)

PMID Text
26898077 FOXP1 is present in normal cells of erythroid and myeloid linages and may have a possible role in development of all hematopoetic cells as well as possible involvement in neoplasm development of myeloid disorders.
26854715 Authors identified forkhead box protein P1 (FOXP1) as a direct target of miR-504 using microarray analysis and a luciferase assay.
26787899 Cell-line derived FOXP1 target genes that were highly correlated with FOXP1 expression in primary DLBCL accurately segregated the corresponding clinical subtypes of a large cohort of primary DLBCL isolates
26729899 S1PR2 is repressed by FOXP1 in activated B-cell and germinal center B-cell DLBCL cell lines with aberrantly high FOXP1 levels; S1PR2 expression is further inversely correlated with FOXP1 expression in 3 DLBCL patient cohorts.
26500140 FOXP1 represents a novel regulator of genes targeted by the class II MHC transactivator CIITA and CD74.
26494785 integral role for FoxP1 in regulating signaling pathways vulnerable in autism and the specific regulation of striatal pathways important for vocal communication
26489674 Studied the expression of FOXP1 in colorectal cancer and its potential associations with outcome in colorectal cancer.
26460480 FOXP1 - novel candidate genes validated in a large case-control sample of schizophrenia.
26383589 we provide supportive evidence that genetic variants at FOXP1, BARX1, and FOXF1 confer risk for the development of EAC.
26367773 FOXP1, TP53INP1, TNFAIP3, and TUSC2 were identified as miR-19a targets.
26289642 FOXP1 overexpression specifically inhibits formation of IgG- but not IgM-secreting Plasma Cells.
26054682 Over-expression of FOXP1 and SPINK1 may participate in the carcinogenesis of hepatitis B virus related cirrhosis.
25895457 FOXP1 expression is closely related to the degree of malignancy of epithelial ovarian cancer and may be a reliable index of the chemoresistance and prognosis of ovarian cancer
25868900 Foxp1 mediates programming of limb-innervating motor neurons from mouse and human embryonic stem cells.
25778315 Abnormal expression of FOXP1 in renal cell carcinoma may create progression of tumor from low grade to high grade by regulating the HIF-1-VEGF pathway.
25650440 FOXP1 has a role in potentiating Wnt/beta-catenin signaling in diffuse large B cell lymphoma
25500588 Data indicate that the mRNA level for forkhead box P1 (FOXP1) and estrogen receptor beta (ERbeta) in ovarian carcinoma tissues decreased, while the expression level of estrogen receptor alpha (ERalpha) mRNA increased.
25406647 Our results suggest that down-regulation of FOXP1 expression is a common event in high-risk neuroblastoma pathogenesis and may contribute to tumor progression and unfavorable patient outcome.
25329375 results suggest a novel mechanism in which AR-induced FOXP1 functions as a direct modulator of the AR and FOXA1 centric global transcriptional network.
25267198 Through direct repression of proapoptotic genes, (aberrant) expression of FOXP1 complements (constitutive) NF-kappaB activity to promote B-cell survival and can thereby contribute to B-cell homeostasis and lymphomagenesis.
25266127 This study demonstrated that Brain-specific Foxp1 deletion impairs neuronal development and causes autistic-like behavior and mental disorders.
24908370 The significant expression of FOXP1 may be helpful to some extent in the pathologic diagnosis of cervical mucinous minimal deviation adenocarcinoma
24893616 our results may suggest a possible broader role of FOXP1 in the pathogenesis and progression of myelodysplasia and acute myeloid leukemia.
24787006 miR-150 can influence the relative expression of GAB1 and FOXP1 and the signaling potential of the B-cell receptor
24416450 Non-immunoglobulin heavy chain rearrangements of FOXP1 are usually acquired during clinical course of various lymphoma subtypes.
24232982 Decreased miR-34a expression and increased FOXP1, p53, and BCL2 coexpression predict poor overall survival for MALT lymphoma and diffuse large B-cell lymphoma patients
24214399 Autistic traits and other behavioral problems are likely to be associated with haploinsufficiency of FOXP1
24211718 High Foxp1 expression is associated with hepatocarcinoma.
24023716 data indicate that FoxP1 is essential for the angiogenic function of endothelial cells and functions as a suppressor of the inhibitory guidance cue semaphorin 5B, suggesting A function of FoxP1 in the regulation of neovascularization.
23810008 Data suggest that FOXP1 and FOXA1 (forkhead box A1) are primary estrogen receptors alpha (ERalpha) target genes and critical transcription factors that regulate ERalpha activity in breast cancer. [REVIEW]
23766104 Results suggest that haploinsufficiency of FOXP1 is associated with human congenital heart defects.
23580662 FOXP1 is physiologically downregulated in germinalo center B cells and that aberrant expression of FOXP1 impairs mechanisms triggered by B-cell activation, potentially contributing to B-cell lymphomagenesis.
22904134 Expression of FoxP1 messenger RNA (mRNA) and protein was significantly higher in NonSmall Cell Lung Carcinoma tissue than in corresponding peritumoral tissue (P = .013 and P < .001, respectively).
22809882 FOXP1 and p65 expression are adverse risk factors in diffuse large B-cell lymphoma
22736042 Our data demonstrated the close relationship between FOXP1 nuclear expression and the occurrence of large tumor cells in MALT lymphoma
22492998 Foxp1 is a transcriptional repressor of immune signaling in the central nervous system.
22476979 Double-positive immunoreactivities of FOXA1 and FOXP1 were significantly associated with a favorable prognosis for the relapse-free and overall survival in with tamoxifen-treated breast cancer.
22422806 These results support a role for FOXP1 as an oncogene in hepatocellular carcinoma.
22401769 forkhead box P1 overexpression was associated with an improved overall survival of the patients with peripheral T-cell lymphoma, not otherwise specified
22368156 FOXP1 gene expression carries a poor prognosis in thyroid diffuse large B-cell lymphomas.
21962897 The PAX5-FOXP1 translocation is associated with B-cell acute lymphoblastic leukemia.
21927029 A reverse correlation between CTGF and miR-504, miR-504 and FOXP1, and a positive correlation between CTGF and FOXP1 were shown.
21924763 Study shows that tembryonic stem cell (ESC)-specific isoform of FOXP1 stimulates expression of transcription factor genes required for pluripotency, OCT4, NANOG, NR5A2, and GDF3, while concomitantly repressing genes required for ESC differentiation.
21901488 FOXP1 plays an important role in proliferation of breast cancer cells by modulating estrogen signaling.
21683954 FoxP1 is expressed by different cell types in atherosclerotic lesions and associated with more stable plaque characteristics and intraplaque TGFbeta signaling
21660567 patients with Non-Hodgkin's lymphoma of mucosa-associated lymphoid tissue that are positive for both PIK3CA and FOXP1 had a worse overall and progression-free survival
21655267 The results indicate that in cancer cells E2A, FOXO1 and FOXP1 regulate RAG1 and RAG2 expression, which initiates Ig gene rearrangement much in the way similar to B lymphocytes.
21606195 These data suggest that the opposing transcriptional activities of FoxP1 and Nfat3 maintain cardiomyocyte homeostasis.
21460242 Myc-mediated repression of microRNA-34a promotes high-grade transformation of B-cell lymphoma by dysregulation of FoxP1.
21416545 Data show that FOXP1 C61S and C61Y mutants existed as a mixture by NMR analysis.
21210727 FOXP1 expression negatively correlated with Ki67 expression in clear cell renal cell carcinomas (p = .036).
21154235 Overexpression of FOXP1 is present in a considerable proportion of primary cutaneous large B cell lymphoma, leg type and might indicate an unfavourable prognosis.
21120478 FOXP1 might play a role in the pathogenesis of nodal diffuse large B-cell lymphoma .
20950788 both FOXP1 and FOXP2 are associated with language impairment, but decrease of the former has a more global impact on brain development than that of the latter.
20848658 Found three heterozygous overlapping deletions solely affecting the FOXP1 gene. All three patients had moderate mental retardation and significant language and speech deficits.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20579129 FOXP1 overexpression was associated with poor disease-specific survival in all nodal diffuse large B-cell lymphomas. There was no correlation between FOXP1 gene aberrations and either FOXP1 protein expression or survival.
20526340 Data show a replicated association of generalized vitiligo with variants at 3p13 encompassing FOXP1.
20526340 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
20190138 These results demonstrate a role of PKCdelta in alpha(M)beta(2)-mediated Foxp1 regulation in monocytes.
19925052 Studies illustrated tools for cut-off level determination with prognostic tumor-related biomarkers Bcl-2, Bcl-6, CD10, FOXP1, MUM1, and Cyclin E in DLBCL.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19760589 FOXP1 is not rearranged in Splenic marginal zone lymphoma
19680146 truncated FOXP1 isoforms are preferentially overexpressed in primary central nervous system lymphomas
19622517 Results suggest that FOXP1 demonstrates different expression patterns in familial breast cancers than sporadic tumours, even in tumours showing similar phenotypes, and also suggest a different role of FOXP1 as a tumour suppressor in familial tumours.
19487025 Our results provide strong evidence that relative FOXP1 isoform abundance is associated with NFkappaB activity in follicular lymphoma, and could potentially be used as a marker for this gene signature
19448593 The expression of CD10, Bcl-6, MUM1/IRF4, Bcl-2, and FOXP1 was determined immunohistochemically from 88 samples of diffuse large B-cell lymphoma patients treated uniformly with R-CHOP
19438754 Atypical FOXP1 expression in malignant plasma cells that show several simultaneous translocations
19432679 FOXP1 might play an important role in plasma cell neoplasm.
19417623 present in patients with higher clinical stages of chronic lymphocytic leukemia
19365123 FOXP1 expression is correlated with morphic histology and may be a biomarker for assessment of malignant transformation.
19352412 FOXP1 mutations have a role in developmental verbal dyspraxia
19352412 Observational study of gene-disease association. (HuGE Navigator)
19141121 expression of Bcl-2 and FOXP1 is associated with the non-germinal center phenotype, but only Bcl-2 expression continues to be of prognostic significance in DLBCL patients treated with immunochemotherapy
18925695 There was an association between FOXP1 and diffuse large B-cell lymphoma: significant relationship between BCL2 expression and FOXP1 genetic abnormalities.
18640093 FOXP1 directly interacts with androgen receptor (AR) and negatively regulates AR signaling ligand-dependently.
18487996 Mechanisms other than translocation and copy number changes are responsible for FOXP1 overexpression in lymphoma.
18332236 FOXP1 protein is present in human endometrium with evidence of cycle stage-dependent changes in expression. FOXP1 expression was found in endometriotic lesions but not in endometrial adenocarcinoma
18077790 The expression of potentially oncogenic smaller FOXP1 isoforms may resolve the previously contradictory findings that FOXP1 represents a favorable prognostic marker in breast cancer and an adverse risk factor in B-cell lymphomas.
18026833 Expression of the forkhead transcription factor FOXP1 is associated with that of estrogen receptor-beta in primary invasive breast carcinomas.
17477366 There may be a hormonal and hypoxia independent regulatory mechanism coordinating the expression of HIFs, the AR, and FOXP1 in prostate tumors.
17199743 Our results suggest that MALT1-specific translocations and FOXP1 rearrangements are not commonly involved in pathogenesis.
16952980 these data implicate specific members of the FOX family of TFs (FOXC1, C2, P1, P4, and O1A) not previously suggested in heart failure pathogenesis.
16673020 rearrangement of FOXP1 is detected in a subset of large B-cell lymphomas with extranodal presentation
16636337 FOXP1 expression is an independent prognostic factor in MALT lymphomas. A subgroup of nongerminal center DLBCLs (Diffuse Large B-Cell Lymphomas, those marked by FOXP1 expression and trisomy 3 and 18) might represent a large-cell variant of MALT lymphomas.
16258506 Tumors with exclusively cytoplasmic expression of FOXP1 were linked with deep myometrial invasion.
16200457 The heterogeneity of FOXP1 expression in germinal centre-derived lymphomas, may have more to do with the transforming events underlying these distinct types of lymphoma than with their common origin.
15709173 Results suggest that FOXP1 expression may be important in diffuse large B-cell lymphoma (DLBCL) pathogenesis.
15703784 This study identifies FOXP1 as a new translocation partner of IGH in a site-dependent subset of MALT lymphomas.
15286807 Integrin engagement regulates monocyte differentiation through FOXP1.
15161711 FOXP1 is a potential ER coregulator in human breast carcinoma and may also independently regulate additional important pathways that control the progression of breast cancer
15056695 FOXP1 and FOXP2 expression patterns in human fetal brain are strikingly similar to those in the songbird, including localization to subcortical structures that function in sensorimotor integration and the control of skilled, coordinated movement
14701752 complex regulatory mechanism underlying Foxp1, Foxp2, and Foxp4 activity, demonstrating that Foxp1, Foxp2, and Foxp4 are the first Fox proteins reported whose activity is regulated by homo- and heterodimerization
12692134 Foxp1, although broadly expressed, is further regulated by tissue-specific alternative splicing of its functionally important sequence domains
11751404 The FOXP1 winged helix transcription factor is a novel candidate tumor suppressor gene on chromosome 3p.

AA Sequence

MMQESGTETKSNGSAIQNGSGGSNHLLECGGLREGRSNGETPAVDIGAADLAHAQQQQQQALQVARQLLL      1 - 70
QQQQQQQVSGLKSPKRNDKQPALQVPVSVAMMTPQVITPQQMQQILQQQVLSPQQLQVLLQQQQALMLQQ     71 - 140
QQLQEFYKKQQEQLQLQLLQQQHAGKQPKEQQQVATQQLAFQQQLLQMQQLQQQHLLSLQRQGLLTIQPG    141 - 210
QPALPLQPLAQGMIPTELQQLWKEVTSAHTAEETTGNNHSSLDLTTTCVSSSAPSKTSLIMNPHASTNGQ    211 - 280
LSVHTPKRESLSHEEHPHSHPLYGHGVCKWPGCEAVCEDFQSFLKHLNSEHALDDRSTAQCRVQMQVVQQ    281 - 350
LELQLAKDKERLQAMMTHLHVKSTEPKAAPQPLNLVSSVTLSKSASEASPQSLPHTPTTPTAPLTPVTQG    351 - 420
PSVITTTSMHTVGPIRRRYSDKYNVPISSADIAQNQEFYKNAEVRPPFTYASLIRQAILESPEKQLTLNE    421 - 490
IYNWFTRMFAYFRRNAATWKNAVRHNLSLHKCFVRVENVKGAVWTVDEVEFQKRRPQKISGNPSLIKNMQ    491 - 560
SSHAYCTPLNAALQASMAENSIPLYTTASMGNPTLGNLASAIREELNGAMEHTNSNESDSSPGRSPMQAV    561 - 630
HPVHVKEEPLDPEEAEGPLSLVTTANHSPDFDHDRDYEDEPVNEDME                           631 - 677
//

Text Mined References (125)

PMID Year Title
26898077 2015 FOXP1 Expression in Normal and Neoplastic Erythroid and Myeloid Cells.
26854715 2016 A tumor-suppressive microRNA, miR-504, inhibits cell proliferation and promotes apoptosis by targeting FOXP1 in human glioma.
26787899 2016 Subtype-specific addiction of the activated B-cell subset of diffuse large B-cell lymphoma to FOXP1.
26729899 2016 The hematopoietic oncoprotein FOXP1 promotes tumor cell survival in diffuse large B-cell lymphoma by repressing S1PR2 signaling.
26647308 2016 Identification and functional characterization of de novo FOXP1 variants provides novel insights into the etiology of neurodevelopmental disorder.
26500140 2016 FOXP1 suppresses immune response signatures and MHC class II expression in activated B-cell-like diffuse large B-cell lymphomas.
26494785 2015 FoxP1 orchestration of ASD-relevant signaling pathways in the striatum.
26489674 2015 Expression of FOXP1 and Colorectal Cancer Prognosis.
26460480 2015 Expression analysis in a rat psychosis model identifies novel candidate genes validated in a large case-control sample of schizophrenia.
26383589 2015 Supportive evidence for FOXP1, BARX1, and FOXF1 as genetic risk loci for the development of esophageal adenocarcinoma.
26367773 2015 Uncovering Direct Targets of MiR-19a Involved in Lung Cancer Progression.
26289642 2015 The forkhead transcription factor FOXP1 represses human plasma cell differentiation.
26054682 2015 FOXP1 and SPINK1 reflect the risk of cirrhosis progression to HCC with HBV infection.
25895457 2015 Expression of FOXP1 in epithelial ovarian cancer (EOC) and its correlation with chemotherapy resistance and prognosis.
25868900 2015 Foxp1-mediated programming of limb-innervating motor neurons from mouse and human embryonic stem cells.
25778315 Expression and significance of FOXP1, HIF-1a and VEGF in renal clear cell carcinoma.
25650440 2015 FOXP1 potentiates Wnt/?-catenin signaling in diffuse large B cell lymphoma.
25500588 2015 The expression and correlation between the transcription factor FOXP1 and estrogen receptors in epithelial ovarian cancer.
25406647 2014 FOXP1 inhibits cell growth and attenuates tumorigenicity of neuroblastoma.
25329375 2014 Integrative analysis of FOXP1 function reveals a tumor-suppressive effect in prostate cancer.
25267198 2014 FOXP1 directly represses transcription of proapoptotic genes and cooperates with NF-?B to promote survival of human B cells.
25266127 2015 Brain-specific Foxp1 deletion impairs neuronal development and causes autistic-like behaviour.
25027557 2015 Transcriptional regulation by FOXP1, FOXP2, and FOXP4 dimerization.
24908370 2014 Forkhead box protein P1 is a useful marker for the diagnosis of mucinous minimal deviation adenocarcinoma of uterine cervix.
24893616 2014 FOXP1 and TP63 involvement in the progression of myelodysplastic syndrome with 5q- and additional cytogenetic abnormalities.
24787006 2014 miR-150 influences B-cell receptor signaling in chronic lymphocytic leukemia by regulating expression of GAB1 and FOXP1.
24416450 2014 Non-IG aberrations of FOXP1 in B-cell malignancies lead to an aberrant expression of N-truncated isoforms of FOXP1.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24232982 2014 Prognostic significance of miR-34a and its target proteins of FOXP1, p53, and BCL2 in gastric MALT lymphoma and DLBCL.
24214399 2013 FOXP1 mutations cause intellectual disability and a recognizable phenotype.
24211718 2014 Effects of lentiviral-mediated Foxp1 and Foxq1 RNAi on the hepatocarcinoma cell.
24121790 2013 A genome-wide association study identifies new susceptibility loci for esophageal adenocarcinoma and Barrett's esophagus.
24023716 2013 FoxP1 stimulates angiogenesis by repressing the inhibitory guidance protein semaphorin 5B in endothelial cells.
24002674 2014 Genome-wide association study and meta-analysis of intraocular pressure.
23810008 2013 FOXP1 and estrogen signaling in breast cancer.
23793025 2013 Genome-wide meta-analysis identifies new susceptibility loci for migraine.
23766104 2013 Genetic abnormalities in FOXP1 are associated with congenital heart defects.
23580662 2013 Downregulation of FOXP1 is required during germinal center B-cell function.
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23166209 2012 Impact of ancestry and common genetic variants on QT interval in African Americans.
22904134 2012 High expression of FoxP1 is associated with improved survival in patients with non-small cell lung cancer.
22809882 2013 Both FOXP1 and p65 expression are adverse risk factors in diffuse large B-cell lymphoma: a retrospective study in China.
22736042 2012 Expression of FOXP1 in mucosa-associated lymphoid tissue lymphoma suggests a large tumor cell transformation and predicts a poorer prognosis in the positive thyroid patients.
22589738 2012 Genome-wide association for abdominal subcutaneous and visceral adipose reveals a novel locus for visceral fat in women.
22492998 2012 Forkhead box protein p1 is a transcriptional repressor of immune signaling in the CNS: implications for transcriptional dysregulation in Huntington disease.
22476979 2012 Association of double-positive FOXA1 and FOXP1 immunoreactivities with favorable prognosis of tamoxifen-treated breast cancer patients.
22422806 2012 Prognostic significance of FOXP1 as an oncogene in hepatocellular carcinoma.
22401769 2012 Forkhead box P1 overexpression and its clinicopathologic significance in peripheral T-cell lymphoma, not otherwise specified.
22368156 2013 Clinicopathologic study and outcome analysis of thyroid lymphomas: experience from a tertiary cancer center.
21962897 2011 FOXP1 and PAX5 are rare but recurrent translocations partners in acute lymphoblastic leukemia.
21947824 2011 The germinal center/activated B-cell subclassification has a prognostic impact for response to salvage therapy in relapsed/refractory diffuse large B-cell lymphoma: a bio-CORAL study.
21934230 Primary cardiac diffuse large B-cell lymphoma with activated B-cell-like phenotype.
21927029 2012 Connective tissue growth factor modulates oral squamous cell carcinoma invasion by activating a miR-504/FOXP1 signalling.
21924763 2011 An alternative splicing switch regulates embryonic stem cell pluripotency and reprogramming.
21901488 2011 FOXP1, an estrogen-inducible transcription factor, modulates cell proliferation in breast cancer cells and 5-year recurrence-free survival of patients with tamoxifen-treated breast cancer.
21832150 2011 Genotypic and phenotypic differences between nodal and extranodal diffuse large B-Cell lymphomas.
21683954 2011 Forkhead box protein P1 as a downstream target of transforming growth factor-? induces collagen synthesis and correlates with a more stable plaque phenotype.
21660567 2011 Expression of PIK3CA and FOXP1 in gastric and intestinal non-Hodgkin's lymphoma of mucosa-associated lymphoid tissue type.
21655267 2011 Transcription factors E2A, FOXO1 and FOXP1 regulate recombination activating gene expression in cancer cells.
21606195 2011 Opposing roles of FoxP1 and Nfat3 in transcriptional control of cardiomyocyte hypertrophy.
21460242 2011 Myc-mediated repression of microRNA-34a promotes high-grade transformation of B-cell lymphoma by dysregulation of FoxP1.
21416545 2011 Solution structure and backbone dynamics of the DNA-binding domain of FOXP1: insight into its domain swapping and DNA binding.
21210727 2011 Expression of the Forkhead transcription factor FOXP1 is associated with tumor grade and Ki67 expression in clear cell renal cell carcinoma.
21154235 2011 FOXP1 molecular cytogenetics and protein expression analyses in primary cutaneous large B cell lymphoma, leg-type.
21120478 2011 FOXP1 expression and its clinicopathologic significance in nodal and extranodal diffuse large B-cell lymphoma.
20950788 2010 De novo mutations in FOXP1 in cases with intellectual disability, autism, and language impairment.
20848658 2010 Identification of FOXP1 deletions in three unrelated patients with mental retardation and significant speech and language deficits.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20579129 2010 FOXP1 protein overexpression is associated with inferior outcome in nodal diffuse large B-cell lymphomas with non-germinal centre phenotype, independent of gains and structural aberrations at 3p14.1.
20526340 2010 Common variants in FOXP1 are associated with generalized vitiligo.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20190138 2010 Integrin alphaMbeta2 clustering triggers phosphorylation and activation of protein kinase C delta that regulates transcription factor Foxp1 expression in monocytes.
19925052 2010 Prognostic immunophenotypic biomarker studies in diffuse large B cell lymphoma with special emphasis on rational determination of cut-off scores.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19760589 2009 FOXP1 status in splenic marginal zone lymphoma: a fluorescence in situ hybridization and immunohistochemistry approach.
19680146 2009 Preferential expression of truncated isoforms of FOXP1 in primary central nervous system lymphoma.
19622517 2009 Expression of the forkhead box transcription factor FOXP1 is associated with oestrogen receptor alpha, oestrogen receptor beta and improved survival in familial breast cancers.
19487025 2009 Relative abundance of full-length and truncated FOXP1 isoforms is associated with differential NFkappaB activity in Follicular Lymphoma.
19448593 2009 Prognostic impact of activated B-cell focused classification in diffuse large B-cell lymphoma patients treated with R-CHOP.
19438754 2009 Atypical FOXP1 expression in malignant plasma cells that show several simultaneous translocations.
19432679 2009 FOXP1 expression in monoclonal gammopathy of undetermined significance and multiple myeloma.
19417623 2009 FOXP1 and BCL2 show similar immunoenzymatic pattern in bone marrow trephines of chronic lymphocytic leukemia patients.
19416867 2009 The transcriptome of human CD34+ hematopoietic stem-progenitor cells.
19365123 2009 FOXP1 expression predicts polymorphic histology and poor prognosis in gastric mucosa-associated lymphoid tissue lymphomas.
19352412 2009 Assessing the impact of FOXP1 mutations on developmental verbal dyspraxia.
19141121 2009 Bcl-2 but not FOXP1, is an adverse risk factor in immunochemotherapy-treated non-germinal center diffuse large B-cell lymphomas.
18925695 2008 Prognostic markers and gene abnormalities in subgroups of diffuse large B-cell lymphoma: single center experience.
18821565 2008 Genome-wide association scan of quantitative traits for attention deficit hyperactivity disorder identifies novel associations and confirms candidate gene associations.
18799727 2008 Down-regulation of the forkhead transcription factor Foxp1 is required for monocyte differentiation and macrophage function.
18640093 2008 FOXP1 is an androgen-responsive transcription factor that negatively regulates androgen receptor signaling in prostate cancer cells.
18487996 2008 FOXP1 abnormalities in lymphoma: translocation breakpoint mapping reveals insights into deregulated transcriptional control.
18347093 2008 Cooperative regulation in development by SMRT and FOXP1.
18332236 2008 Expression of Fox head protein 1 in human eutopic endometrium and endometriosis.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
18077790 2008 Potentially oncogenic B-cell activation-induced smaller isoforms of FOXP1 are highly expressed in the activated B cell-like subtype of DLBCL.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
18026833 2008 Expression of the forkhead transcription factor FOXP1 is associated with that of estrogen receptor-beta in primary invasive breast carcinomas.
17477366 2007 Expression of the forkhead transcription factor FOXP1 is associated both with hypoxia inducible factors (HIFs) and the androgen receptor in prostate cancer but is not directly regulated by androgens or hypoxia.
17344859 2007 Genome-wide analysis of genetic alterations in acute lymphoblastic leukaemia.
17199743 2007 MALT1, BCL10 and FOXP1 in salivary gland mucosa-associated lymphoid tissue lymphomas.
16952980 2006 Transcriptional genomics associates FOX transcription factors with human heart failure.
16673020 2006 Genetic rearrangement of FOXP1 is predominantly detected in a subset of diffuse large B-cell lymphomas with extranodal presentation.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16636337 2006 Forkhead box protein P1 expression in mucosa-associated lymphoid tissue lymphomas predicts poor prognosis and transformation to diffuse large B-cell lymphoma.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16258506 2006 Loss of expression and nuclear/cytoplasmic localization of the FOXP1 forkhead transcription factor are common events in early endometrial cancer: relationship with estrogen receptors and HIF-1alpha expression.
16200457 2005 The FOXP1 transcription factor is expressed in the majority of follicular lymphomas but is rarely expressed in classical and lymphocyte predominant Hodgkin's lymphoma.
15709173 2005 Expression of the FOXP1 transcription factor is strongly associated with inferior survival in patients with diffuse large B-cell lymphoma.
15703784 2005 T(3;14)(p14.1;q32) involving IGH and FOXP1 is a novel recurrent chromosomal aberration in MALT lymphoma.
15492844 2004 Human FOX gene family (Review).
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15286807 2004 Integrin engagement regulates monocyte differentiation through the forkhead transcription factor Foxp1.
15161711 2004 Expression of the forkhead transcription factor FOXP1 is associated with estrogen receptor alpha and improved survival in primary human breast carcinomas.
15056695 2004 Parallel FoxP1 and FoxP2 expression in songbird and human brain predicts functional interaction.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14701752 2004 Transcriptional and DNA binding activity of the Foxp1/2/4 family is modulated by heterotypic and homotypic protein interactions.
12692134 2003 Multiple domains define the expression and regulatory properties of Foxp1 forkhead transcriptional repressors.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11757404 2001 [Occurrence of beta-lactamase type ESBL and IBL in Pseudomonas aeruginosa rods].
11751404 2001 The FOXP1 winged helix transcription factor is a novel candidate tumor suppressor gene on chromosome 3p.
11042152 2000 Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells.
8265594 1993 DNA-binding properties and secondary structural model of the hepatocyte nuclear factor 3/fork head domain.
7566098 1995 Initial assessment of human gene diversity and expression patterns based upon 83 million nucleotides of cDNA sequence.