Property Summary

NCBI Gene PubMed Count 8
PubMed Score 11.09
PubTator Score 5.34

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
juvenile dermatomyositis 1187 4.1e-11
Breast cancer 3578 9.7e-06
osteosarcoma 7950 5.3e-05
primary Sjogren syndrome 735 4.3e-04
invasive ductal carcinoma 2951 1.0e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (5)

Disease log2 FC p
Breast cancer 1.200 9.7e-06
invasive ductal carcinoma -1.600 1.0e-02
juvenile dermatomyositis 1.116 4.1e-11
osteosarcoma -1.646 5.3e-05
primary Sjogren syndrome 1.100 4.3e-04

Gene RIF (3)

AA Sequence

MGPVIGMTPDKRAETPGAEKIAGLSQIYKMGSLPEAVDAARPKATLVDSESADDELTNLNWLHESTNLLT      1 - 70
NFSLGSEGLPIVSPLYDIEGDDVPSFGPACYQNPEKKSATSKPPYSFSLLIYMAIEHSPNKCLPVKEIYS     71 - 140
WILDHFPYFATAPTGWKNSVRHNLSLNKCFQKVERSHGKVNGKGSLWCVDPEYKPNLIQALKKQPFSSAS    141 - 210
SQNGSLSPHYLSSVIKQNQVRNLKESDIDAAAAMMLLNTSIEQGILECEKPLPLKTALQKKRSYGNAFHH    211 - 280
PSAVRLQESDSLATSIDPKEDHNYSASSMAAQRCASRSSVSSLSSVDEVYEFIPKNSHVGSDGSEGFHSE    281 - 350
EDTDVDYEDDPLGDSGYASQPCAKISEKGQSGKKMRKQTCQEIDEELKEAAGSLLHLAGIRTCLGSLIST    351 - 420
AKTQNQKQRKK                                                               421 - 431
//

Text Mined References (10)

PMID Year Title