Property Summary

NCBI Gene PubMed Count 19
PubMed Score 26.85
PubTator Score 13.66

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q12952 Q17RR1 Q9H242
Symbols FKH6
FKHL11
FREAC7

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (8)

PMID Text
26062977 the downregulation of FOXL1 expression was associated with osteosarcoma cell growth. Restoration of FOXL1 gene expression by gene therapy may have a therapeutic potential for patients with osteosarcoma
25010679 dysregulated FOXL1 is involved in tumorigenesis and progression of gallbladder cancer.
24427331 results suggest that Foxl1 plays an inhibitory role in renal tumor progression.
23801748 Lower FOXL1 expression is correlated with metastasis and advanced pathologic stage of pancreatic cancer.
21536545 FUS-CREB3L2/L1-positive sarcomas show a specific gene expression profile with upregulation of CD24 and FOXL1.
21457232 two novel de novo mutations in rare patients inherited gene variants in FOXL1.
20198651 Observational study of gene-disease association. (HuGE Navigator)
18564921 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MSHLFDPRLPALAASPMLYLYGPERPGLPLAFAPAAALAASGRAETPQKPPYSYIALIAMAIQDAPEQRV      1 - 70
TLNGIYQFIMDRFPFYHDNRQGWQNSIRHNLSLNDCFVKVPREKGRPGKGSYWTLDPRCLDMFENGNYRR     71 - 140
RKRKPKPGPGAPEAKRPRAETHQRSAEAQPEAGSGAGGSGPAISRLQAAPAGPSPLLDGPSPPAPLHWPG    141 - 210
TASPNEDAGDAAQGAAAVAVGQAARTGDGPGSPLRPASRSSPKSSDKSKSFSIDSILAGKQGQKPPSGDE    211 - 280
LLGGAKPGPGGRLGASLLAASSSLRPPFNASLMLDPHVQGGFYQLGIPFLSYFPLQVPDTVLHFQ         281 - 345
//

Text Mined References (20)

PMID Year Title
26062977 2015 Inhibitory effects of forkhead box L1 gene on osteosarcoma growth through the induction of cell cycle arrest and apoptosis.
25010679 2014 Forkhead box L1 is frequently downregulated in gallbladder cancer and inhibits cell growth through apoptosis induction by mitochondrial dysfunction.
24430505 2014 Genetic determinants of heel bone properties: genome-wide association meta-analysis and replication in the GEFOS/GENOMOS consortium.
24427331 2014 Foxl1 inhibits tumor invasion and predicts outcome in human renal cancer.
24249740 2014 Multistage genome-wide association meta-analyses identified two new loci for bone mineral density.
23801748 2013 FOXL1, a novel candidate tumor suppressor, inhibits tumor aggressiveness and predicts outcome in human pancreatic cancer.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
22504420 2012 Genome-wide meta-analysis identifies 56 bone mineral density loci and reveals 14 loci associated with risk of fracture.
21536545 2011 FUS-CREB3L2/L1-positive sarcomas show a specific gene expression profile with upregulation of CD24 and FOXL1.
21457232 2012 Identification of de novo mutations and rare variants in hypoplastic left heart syndrome.
20198651 2010 Mutational analysis of FOXL2 codon 134 in granulosa cell tumour of ovary and other human cancers.
19801982 2009 Twenty bone-mineral-density loci identified by large-scale meta-analysis of genome-wide association studies.
18564921 2008 Candidate gene analysis in primary lymphedema.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15188402 2004 Proteins associated with type II bone morphogenetic protein receptor (BMPR-II) and identified by two-dimensional gel electrophoresis and mass spectrometry.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11078474 2000 Mutations in FOXC2 (MFH-1), a forkhead family transcription factor, are responsible for the hereditary lymphedema-distichiasis syndrome.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
7957066 1994 Cloning and characterization of seven human forkhead proteins: binding site specificity and DNA bending.