Property Summary

NCBI Gene PubMed Count 24
PubMed Score 29.68
PubTator Score 18.26

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
colon cancer -2.800 1.3e-03
cystic fibrosis 2.668 4.2e-07
lung adenocarcinoma -1.500 4.5e-11
lung cancer -1.700 3.7e-03
malignant mesothelioma -2.600 1.9e-08
non-small cell lung cancer -1.016 2.8e-07
osteosarcoma 1.571 2.8e-02
ovarian cancer 1.100 5.3e-05
sonic hedgehog group medulloblastoma 1.700 3.3e-03

Gene RIF (16)

AA Sequence

MTTEGGPPPAPLRRACSPVPGALQAALMSPPPAAAAAAAAAPETTSSSSSSSSASCASSSSSSNSASAPS      1 - 70
AACKSAGGGGAGAGSGGAKKASSGLRRPEKPPYSYIALIVMAIQSSPSKRLTLSEIYQFLQARFPFFRGA     71 - 140
YQGWKNSVRHNLSLNECFIKLPKGLGRPGKGHYWTIDPASEFMFEEGSFRRRPRGFRRKCQALKPMYHRV    141 - 210
VSGLGFGASLLPQGFDFQAPPSAPLGCHSQGGYGGLDMMPAGYDAGAGAPSHAHPHHHHHHHVPHMSPNP    211 - 280
GSTYMASCPVPAGPGGVGAAGGGGGGDYGPDSSSSPVPSSPAMASAIECHSPYTSPAAHWSSPGASPYLK    281 - 350
QPPALTPSSNPAASAGLHSSMSSYSLEQSYLHQNAREDLSVGLPRYQHHSTPVCDRKDFVLNFNGISSFH    351 - 420
PSASGSYYHHHHQSVCQDIKPCVM                                                  421 - 444
//

Text Mined References (25)

PMID Year Title