Property Summary

NCBI Gene PubMed Count 17
PubMed Score 4.51
PubTator Score 9.33

Knowledge Summary

Patent

No data available

Expression

Gene RIF (2)

PMID Text
22876580 FOXd4 encodes forkhead box D4 protein.
17273782 The W148R mutation disrupts an extremely highly conserved tryptophan residue in the forkhead domain of FOXD4, possibly resulting in reduced DNA binding capacity and altered transcriptional activity.

AA Sequence

MNLPRAERLRSTPQRSLRDSDGEDGKIDVLGEEEDEDEEEAASQQFLEQSLQPGLQVARWGGVALPREHI      1 - 70
EGGGGPSDPSEFGTEFRAPPRSAAASEDARQPAKPPSSYIALITMAILQSPHKRLTLSGICAFISDRFPY     71 - 140
YRRKFPAWQNSIRHNLSLNDCFVKIPREPGRPGKGNYWSLDPASQDMFDNGSFLRRRKRFQRHQPTPGAH    141 - 210
LPHPFPLPAAHAALHNPRPGPLLGAPAPPQPVPGAYPNTGPGRRPYALLHPHPPRYLLLSAPAYAGAPKK    211 - 280
AEGADLATPAPFPCCSPHLVLSLGRRARVWRRHREADASLSALRVSCKGSGERVQGLRRVCPRPRGATAP    281 - 350
CSSDRQACRTILQQQQRHQEEDCANGCAPTKGAVLGGHLSAASALLRYQAVAEGSGLTSLAAPLGGEGTS    351 - 420
PVFLVSPTPSSLAESAGPS                                                       421 - 439
//

Text Mined References (17)

PMID Year Title
22876580 2012 Pure distal 9p deletion in a female infant with cerebral palsy.
21948691 2011 Maternally inherited partial monosomy 9p (pter???p24.1) and partial trisomy 20p (pter???p12.1) characterized by microarray comparative genomic hybridization.
21482378 2011 Inv dup del(9p): prenatal diagnosis and molecular cytogenetic characterization by fluorescence in situ hybridization and array comparative genomic hybridization.
20650821 2010 Update of human and mouse forkhead box (FOX) gene families.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17273782 2007 A W148R mutation in the human FOXD4 gene segregating with dilated cardiomyopathy, obsessive-compulsive disorder, and suicidality.
15492844 2004 Human FOX gene family (Review).
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15233989 2004 Diverse fates of paralogs following segmental duplication of telomeric genes.
15164053 2004 DNA sequence and analysis of human chromosome 9.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12421752 2002 Gene content and function of the ancestral chromosome fusion site in human chromosome 2q13-2q14.1 and paralogous regions.
12234674 2002 FOXD4a and FOXD4b, two new winged helix transcription factors, are expressed in human leukemia cell lines.
9325056 1997 Chromosome localization, sequence analysis, and expression pattern identify FKHL 18 as a novel human forkhead gene.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8825632 1995 Chromosomal localization of six human forkhead genes, freac-1 (FKHL5), -3 (FKHL7), -4 (FKHL8), -5 (FKHL9), -6 (FKHL10), and -8 (FKHL12).
7957066 1994 Cloning and characterization of seven human forkhead proteins: binding site specificity and DNA bending.