Property Summary

NCBI Gene PubMed Count 26
PubMed Score 456.18
PubTator Score 62.57

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count P-value
psoriasis 6685 8.8e-18
pilocytic astrocytoma 3086 2.6e-02
Disease Target Count Z-score Confidence
Vascular disease 281 0.0 1.0
Disease Target Count Z-score Confidence
Entropion 12 3.511 1.8
Vestibular nystagmus 7 3.46 1.7
Vitiligo 71 3.389 1.7
Disease Target Count
Autoimmune disease 1 1

Expression

  Differential Expression (2)

Disease log2 FC p
pilocytic astrocytoma 1.200 2.6e-02
psoriasis -1.200 8.8e-18

Gene RIF (21)

PMID Text
26898989 The present study finds that the aspirin-FOXD3-OLA1P2-STAT3 axis exhibits exciting anticancer effects and provides new insights into the chemopreventive mechanisms underlying aspirin use
26341266 FOXD3 overexpression significantly inhibits cell growth and results in G1 cell cycle arrest in NSCLC A549 and H1299 cells.
26267147 In addition to a possible association of rs78645479 in FoxD3 with vitiligo, our data on the association of this FoxD3 variant with thyroid autoantibodies suggest a potential involvement of FoxD3 in thyroid immunoregulation.
26252164 FOXD3 is sufficient but not necessary to drive PAX3 expression in melanoma cells.
26205821 Data show that transcription factors PAX3 and FOXD3-mediated melanoma cell migration is dependent on promoting the expression of chemokine receptor CXCR4.
26112097 Down-regulation of FOXD3 is associated with metastasis in hepatocellular carcinoma.
26011451 FOXD3 might serve as an independent prognostic biomarker and a potential therapeutic target for high-grade gliomas, which warrant further investigation.
25061102 FOXD3 and TWIST1 define distinct subgroups of cells within a heterogeneous tumor.
24970808 Findings indicate that miR-137 is a valuable biomarker for hepatocellular carcinoma (HCC) prognosis and the forkhead box D3 (FoxD3)/miR-137/AKT2 regulatory network plays an important role in HCC progression.
24632201 Our results indicate FOXD3 exhibits tumor suppressive activity and may be useful for breast therapy.
24551288 Results suggest an inverse relationship between FoxD3 expression and tumor metastasis in invasive ductal carcinomas of the breast.
24269992 Results indicate that FOXD3 exhibits tumor suppressive activity that affects the growth, aggressiveness and angiogenesis of NB through transcriptional regulation of NDRG1.
23858437 Foxd3 is both sufficient and necessary for regulating the balance between melanocyte and Schwann cell development. In addition, Foxd3 is also sufficient to regulate the switch between neuronal and glial fates in sensory ganglia.
23543055 upregulation of ERBB3 is involved in melanoma adapting to RAF/MEK inhibitors through FOXD3
23058321 Methylation profile analyses identified the promoter of FOXD3 as the only genomic region with increased methylation in mice and humans during progression of Helicobacter pylori-associated gastric tumors.
22887036 A balance of FOXD3 activity is required to maintain pluripotency and paraxial mesoderm fates.
22815627 Six nonsynonymous FOXD3 variants were identified in human ocular disease.
21478267 FOXD3 regulates migration properties and Rnd3 expression in melanoma cells
20332228 Studies show FOXD3 is suppressed by B-RAF, uncover a novel role and mechanism for FOXD3 as a negative cell cycle regulator, and have implications for the repression of melanocytic lineage cells.
19034670 HIV-1 induces OTK18 expression through a YIN-YANG-1 mediated manner in human macrophages, although its gene expression is suppressed by FoxD3 upregulation
16098053 candidate for vitilago susceptibility and autosomal dominant with promoter variation

AA Sequence

MTLSGGGSASDMSGQTVLTAEDVDIDVVGEGDDGLEEKDSDAGCDSPAGPPELRLDEADEVPPAAPHHGQ      1 - 70
PQPPHQQPLTLPKEAAGAGAGPGGDVGAPEADGCKGGVGGEEGGASGGGPGAGSGSAGGLAPSKPKNSLV     71 - 140
KPPYSYIALITMAILQSPQKKLTLSGICEFISNRFPYYREKFPAWQNSIRHNLSLNDCFVKIPREPGNPG    141 - 210
KGNYWTLDPQSEDMFDNGSFLRRRKRFKRHQQEHLREQTALMMQSFGAYSLAAAAGAAGPYGRPYGLHPA    211 - 280
AAAGAYSHPAAAAAAAAAAALQYPYALPPVAPVLPPAVPLLPSGELGRKAAAFGSQLGPGLQLQLNSLGA    281 - 350
AAAAAGTAGAAGTTASLIKSEPSARPSFSIENIIGGGPAAPGGSAVGAGVAGGTGGSGGGSTAQSFLRPP    351 - 420
GTVQSAALMATHQPLSLSRTTATIAPILSVPLSGQFLQPAASAAAAAAAAAQAKWPAQ                421 - 478
//

Text Mined References (26)

PMID Year Title
26898989 2016 The aspirin-induced long non-coding RNA OLA1P2 blocks phosphorylated STAT3 homodimer formation.
26341266 2015 FOXD3 suppresses tumor growth and angiogenesis in non-small cell lung cancer.
26267147 2015 A novel FoxD3 Variant Is Associated With Vitiligo and Elevated Thyroid Auto-Antibodies.
26252164 2016 FOXD3 Promotes PAX3 Expression in Melanoma Cells.
26205821 2015 PAX3 and FOXD3 Promote CXCR4 Expression in Melanoma.
26112097 2015 Hypermethylation of FOXD3 suppresses cell proliferation, invasion and metastasis in hepatocellular carcinoma.
26011451 2015 Decreased FOXD3 Expression Is Associated with Poor Prognosis in Patients with High-Grade Gliomas.
25061102 2014 FOXD3 modulates migration through direct transcriptional repression of TWIST1 in melanoma.
24970808 2014 FoxD3-regulated microRNA-137 suppresses tumour growth and metastasis in human hepatocellular carcinoma by targeting AKT2.
24632201 2014 FoxD3 deficiency promotes breast cancer progression by induction of epithelial-mesenchymal transition.
24551288 2014 Downregulation of the transcription factor, FoxD3, is associated with lymph node metastases in invasive ductal carcinomas of the breast.
24269992 2013 FOXD3 is a novel tumor suppressor that affects growth, invasion, metastasis and angiogenesis of neuroblastoma.
23858437 2013 Neural crest and Schwann cell progenitor-derived melanocytes are two spatially segregated populations similarly regulated by Foxd3.
23543055 2013 Melanoma adapts to RAF/MEK inhibitors through FOXD3-mediated upregulation of ERBB3.
23058321 2013 Helicobacter pylori causes epigenetic dysregulation of FOXD3 to promote gastric carcinogenesis.
22887036 2012 Modulation of FOXD3 activity in human embryonic stem cells directs pluripotency and paraxial mesoderm fates.
22815627 2012 Analysis of FOXD3 sequence variation in human ocular disease.
22306510 2012 Identification of Rhit as a novel transcriptional repressor of human Mpv17-like protein with a mitigating effect on mitochondrial dysfunction, and its transcriptional regulation by FOXD3 and GABP.
21478267 2011 FOXD3 regulates migration properties and Rnd3 expression in melanoma cells.
20332228 2010 FOXD3 is a mutant B-RAF-regulated inhibitor of G(1)-S progression in melanoma cells.
19034670 2009 YY1 and FoxD3 regulate antiretroviral zinc finger protein OTK18 promoter activation induced by HIV-1 infection.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16098053 2005 Candidate functional promoter variant in the FOXD3 melanoblast developmental regulator gene in autosomal dominant vitiligo.
11891324 2002 The embryonic stem cell transcription factors Oct-4 and FoxD3 interact to regulate endodermal-specific promoter expression.
11179011 2001 Analyses of the effects that disease-causing missense mutations have on the structure and function of the winged-helix protein FOXC1.
8499623 1993 Drosophila forkhead homologues are expressed in a lineage-restricted manner in human hematopoietic cells.