Property Summary

NCBI Gene PubMed Count 22
PubMed Score 24.16
PubTator Score 15.62

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count
Prostatic Neoplasms 471
Disease Target Count P-value
uncontrolled asthma 67 5.9e-04

Expression

  Differential Expression (1)

Disease log2 FC p
uncontrolled asthma 1.100 5.9e-04

Gene RIF (7)

PMID Text
25672906 Our study identified novel FOXA3 variants and mutations, assessed the adipogenic capacity of two novel missense alterations in vitro and demonstrated for the first time the associations between FOXA3 SNP rs28666870 with metabolic phenotypes in humans.
24392884 Foxa3 induces goblet cell metaplasia and inhibits innate antiviral immunity in asthma and chronic obstructive pulmonary disease.
23798556 In obese subjects, FOXA3 is differentially expressed in visceral and subcutaneous adipose depots.
22659429 low caloric intake decreases the production of intracellular reactive oxygen species and suppresses endothelial cells senescence through promoting HNF3gamma binging to NOX4 promoter region and inhibiting NOX4 gene expression induced by up-regulated HNF3gamma
19934400 Observational study of gene-disease association. (HuGE Navigator)
19919681 analysis of the binding pattern of FOXA1 and FOXA3 and their relation to H3K4me3 in HepG2 cells
15737987 the HNF-3 site in the fibrinogen beta promoter is important for IL6-induced expression, and its activity is influenced by the adjacent -148C/T polymorphism

AA Sequence

MLGSVKMEAHDLAEWSYYPEAGEVYSPVTPVPTMAPLNSYMTLNPLSSPYPPGGLPASPLPSGPLAPPAP      1 - 70
AAPLGPTFPGLGVSGGSSSSGYGAPGPGLVHGKEMPKGYRRPLAHAKPPYSYISLITMAIQQAPGKMLTL     71 - 140
SEIYQWIMDLFPYYRENQQRWQNSIRHSLSFNDCFVKVARSPDKPGKGSYWALHPSSGNMFENGCYLRRQ    141 - 210
KRFKLEEKVKKGGSGAATTTRNGTGSAASTTTPAATVTSPPQPPPPAPEPEAQGGEDVGALDCGSPASST    211 - 280
PYFTGLELPGELKLDAPYNFNHPFSINNLMSEQTPAPPKLDVGFGGYGAEGGEPGVYYQGLYSRSLLNAS    281 - 350
//

Text Mined References (23)

PMID Year Title
25672906 2015 Analysis of variants and mutations in the human winged helix FOXA3 gene and associations with metabolic traits.
24392884 2014 Foxa3 induces goblet cell metaplasia and inhibits innate antiviral immunity.
23798556 2013 The winged helix transcription factor Foxa3 regulates adipocyte differentiation and depot-selective fat tissue expansion.
22659429 2012 [Caloric restriction suppresses endothelial cells senescence via down-regulation of NOX4 induced by HNF3?].
19934400 2010 Genetic predictors of interindividual variability in hepatic CYP3A4 expression.
19919681 2009 Differential binding and co-binding pattern of FOXA1 and FOXA3 and their relation to H3K4me3 in HepG2 cells revealed by ChIP-seq.
19706729 2009 Regulation of the CYP3A4 and CYP3A7 promoters by members of the nuclear factor I transcription factor family.
18239190 2008 Foxp2 inhibits Nkx2.1-mediated transcription of SP-C via interactions with the Nkx2.1 homeodomain.
15839736 2005 Differentiation of insulin-producing cells from human neural progenitor cells.
15737987 2005 A hepatocyte nuclear factor-3 site in the fibrinogen beta promoter is important for interleukin 6-induced expression, and its activity is influenced by the adjacent -148C/T polymorphism.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12695546 2003 Transcriptional regulation of human CYP3A4 basal expression by CCAAT enhancer-binding protein alpha and hepatocyte nuclear factor-3 gamma.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11748221 2002 HMGB1 interacts with many apparently unrelated proteins by recognizing short amino acid sequences.
10920385 2000 The hepatocyte nuclear factor 3 (HNF3 or FOXA) family in metabolism.
10899756 The human HNF-3 genes: cloning, partial sequence and mutation screening in patients with impaired glucose homeostasis.
9632808 1998 Targeted disruption of the gene encoding hepatocyte nuclear factor 3gamma results in reduced transcription of hepatocyte-specific genes.
9369482 1997 The role of HNF1alpha, HNF3gamma, and cyclic AMP in glucose-6-phosphatase gene activation.
9119385 1997 Assignment of the human genes for hepatocyte nuclear factor 3-alpha, -beta, and -gamma (HNF3A, HNF3B, HNF3G) to 14q12-q13, 20p11, and 19q13.2-q13.4.
8499623 1993 Drosophila forkhead homologues are expressed in a lineage-restricted manner in human hematopoietic cells.
8332212 1993 Co-crystal structure of the HNF-3/fork head DNA-recognition motif resembles histone H5.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7739897 1995 Analysis of hepatocyte nuclear factor-3 beta protein domains required for transcriptional activation and nuclear targeting.