Property Summary

NCBI Gene PubMed Count 42
PubMed Score 129.55
PubTator Score 59.57

Knowledge Summary

Patent

No data available

Expression

AA Sequence

MYQDYPGNFDTSSRGSSGSPAHAESYSSGGGGQQKFRVDMPGSGSAFIPTINAITTSQDLQWMVQPTVIT      1 - 70
SMSNPYPRSHPYSPLPGLASVPGHMALPRPGVIKTIGTTVGRRRRDEQLSPEEEEKRRIRRERNKLAAAK     71 - 140
CRNRRRELTEKLQAETEELEEEKSGLQKEIAELQKEKEKLEFMLVAHGPVCKISPEERRSPPAPGLQPMR    141 - 210
SGGGSVGAVVVKQEPLEEDSPSSSSAGLDKAQRSVIKPISIAGGFYGEEPLHTPIVVTSTPAVTPGTSNL    211 - 280
VFTYPSVLEQESPASPSESCSKAHRRSSSSGDQSSDSLNSPTLLAL                            281 - 326
//