Property Summary

NCBI Gene PubMed Count 42
PubMed Score 129.55
PubTator Score 59.57

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count
Juvenile arthritis 126
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Crohn's disease 321 0.0 3.0
Type 1 diabetes mellitus 109 0.0 1.8
Disease Target Count Z-score Confidence
Systemic scleroderma 60 3.809 1.9
Cancer 2499 3.253 1.6

Expression

  Differential Expression (34)

Disease log2 FC p
glioblastoma 1.600 4.4e-03
acute quadriplegic myopathy 2.120 1.6e-10
adrenocortical carcinoma -1.028 7.0e-05
aldosterone-producing adenoma -1.387 4.6e-02
astrocytic glioma -2.100 1.9e-02
Astrocytoma, Pilocytic -1.100 3.6e-02
atypical teratoid / rhabdoid tumor 1.200 3.7e-02
chronic lymphosyte leukemia -1.100 9.3e-09
chronic rhinosinusitis -1.342 2.8e-02
ependymoma -1.300 4.1e-03
gastric cancer -1.100 2.3e-02
hepatocellular carcinoma -1.600 2.6e-05
interstitial cystitis -1.200 1.5e-03
intraductal papillary-mucinous adenoma (... 1.600 2.0e-03
intraductal papillary-mucinous carcinoma... 1.300 4.6e-03
juvenile dermatomyositis 1.020 3.5e-08
lung cancer -3.500 1.0e-04
lung carcinoma -1.800 7.7e-13
malignant mesothelioma -1.300 1.1e-06
medulloblastoma -1.500 4.9e-03
medulloblastoma, large-cell -1.800 5.3e-03
non diabetic and post-ischemic heart fai... -1.100 3.9e-03
oligodendroglioma -2.400 6.5e-03
osteosarcoma 1.340 5.1e-03
ovarian cancer 2.800 1.0e-05
pancreatic cancer -1.100 2.4e-03
pancreatic carcinoma -1.100 2.4e-03
pancreatic ductal adenocarcinoma liver m... 1.075 3.2e-02
pediatric high grade glioma 1.100 1.3e-02
pituitary cancer -2.700 1.3e-04
primitive neuroectodermal tumor -1.700 2.3e-03
psoriasis -1.200 1.1e-05
spina bifida -2.083 4.3e-02
tuberculosis -1.200 7.4e-04

Gene RIF (19)

AA Sequence

MYQDYPGNFDTSSRGSSGSPAHAESYSSGGGGQQKFRVDMPGSGSAFIPTINAITTSQDLQWMVQPTVIT      1 - 70
SMSNPYPRSHPYSPLPGLASVPGHMALPRPGVIKTIGTTVGRRRRDEQLSPEEEEKRRIRRERNKLAAAK     71 - 140
CRNRRRELTEKLQAETEELEEEKSGLQKEIAELQKEKEKLEFMLVAHGPVCKISPEERRSPPAPGLQPMR    141 - 210
SGGGSVGAVVVKQEPLEEDSPSSSSAGLDKAQRSVIKPISIAGGFYGEEPLHTPIVVTSTPAVTPGTSNL    211 - 280
VFTYPSVLEQESPASPSESCSKAHRRSSSSGDQSSDSLNSPTLLAL                            281 - 326
//

Text Mined References (54)

PMID Year Title