Property Summary

NCBI Gene PubMed Count 307
PubMed Score 13094.72
PubTator Score 3823.55

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Cancer 2346 5.833 2.9

Expression

  Differential Expression (33)

Disease log2 FC p
Rheumatoid Arthritis 1.800 5.4e-04
nephrosclerosis -2.599 9.3e-04
gastric cancer -1.700 2.2e-04
hepatocellular carcinoma -1.200 5.8e-03
Waldenstrons macroglobulinemia 1.126 4.9e-02
urothelial carcinoma -2.900 2.2e-03
malignant mesothelioma 1.200 1.8e-06
chronic lymphosyte leukemia -3.300 6.6e-12
group 4 medulloblastoma -2.400 6.0e-03
astrocytoma 3.300 2.1e-03
glioblastoma 3.300 1.2e-03
periodontitis 1.200 2.2e-12
limb girdle muscular dystrophy 2I 1.974 3.1e-02
fascioscapulohumeral muscular dystrophy 1.962 5.4e-03
adrenocortical carcinoma -2.000 6.4e-03
non-small cell lung cancer -2.300 2.2e-02
lung cancer -3.900 3.2e-07
colon cancer -2.500 2.0e-02
breast carcinoma -2.100 1.2e-04
fibroadenoma -2.700 1.0e-02
lung adenocarcinoma -1.300 1.6e-06
posterior fossa group A ependymoma 1.300 1.0e-02
non primary Sjogren syndrome sicca -1.400 2.9e-02
aldosterone-producing adenoma -2.293 1.5e-02
psoriasis -3.400 4.4e-12
inflammatory breast cancer -5.700 3.4e-11
lung carcinoma -2.400 3.2e-09
pterygium -3.500 2.7e-02
acute myeloid leukemia 1.400 3.1e-02
ulcerative colitis 2.600 9.3e-04
ovarian cancer 2.300 2.1e-03
pituitary cancer -3.800 2.2e-05
Down syndrome 1.300 3.4e-02

Gene RIF (241)

PMID Text
26988982 These results indicate that IL-17A enhances COX2 expression and PGE2 production via the p38/c-Fos and JNK/c-Jun signalling pathways in NP cells to mediate intervertebral disc inflammation.
26858249 Simultaneous high expression of ID1 and c-Jun or c-Fos was correlated with poor survival in esophageal squamous cell carcinoma patients.
26631725 A novel AP-1 binding site at -1363 bp of the human TF promoter region was identified.
26493679 Increased c-Fos expression is through TRPM3-mediated stimulation of the c-Fos promoter.
26381409 The RNA binding complexes NF45-NF90 and NF45-NF110 associate dynamically with the c-fos gene and function as transcriptional coactivators.
26303532 These results establish c-Fos homodimers as a novel form of the AP-1 complex that may be an autonomous transcription factor in c-Fos-overexpressing tissues and could contribute to tumor development.
26209639 Data show that interleukin-1 receptor type 2 (IL1R2) forms a complex with c-Fos proto-oncogene protein and activates the interleukin-6 (IL-6) and vascular endothelial growth factor A (VEGF-A) promoters.
26173738 The translocation causes truncation of the FOS protein, with loss of the transactivation domain, which is thereby a novel mechanism involved in tumorigenesis.
26112171 miR-146a has a role in targeting Fos expression in human cardiac cells
26018080 co-expression of c-Fos or Fra1 was able to cooperate with TAp73 in potentiating cellular growth, similarly to c-Jun. These data together suggest that TAp73 plays a vital role in activation of AP-1 target genes via direct binding to c-Jun
25903346 c-Fos promotes the progression of viral transcription from early to late stages and accelerates viral lytic replication upon sustained ORF45-ERK-RSK activation during the Kaposi's Sarcoma-Associated Herpesvirus lytic life cycle.
25706621 the results of this study suggest that FOS is among the candidate genes of schizophrenia and that changes in the expression of c-Fos protein may contribute to molecular mechanisms of schizophrenia-related alterations in synaptic plasticity.
25670814 O-GlcNAcylation of MLL5beta at T440 residue is critical for MLL5 recruitment to the HPV16/18-long control region through its interaction with AP-1.
25647783 ERK1 and ERK2 regulated the expression of c-Fos and c-Jun proteins in human cervical cancer cells.
25588078 Data suggest that p38 MAP kinase regulates c-Fos/cellular oncogene fos mRNA stability/decay by affecting state of phosphorylation of ELAVL1/HuR (Hu antigen R).
25544773 Data indicate that deregulation of transcription factor AP-1 and microRNA-21-mediated axis led to an enhanced cell growth in hepatocellular carcinoma (HCC).
25384976 CDK12 plays an important role in cotranscriptional processing of c-FOS transcripts
25157104 SMAR1 has a role in repressing c-Fos-mediated HPV18 E6 transcription through alteration of chromatin histone deacetylation
25077945 Endoplasmic reticulum stress activates the hepatic AP-1 complex via MAPK-dependent signaling pathways.
25064159 HIV-1 Tat activates AP-1 (c-Jun/c-Fos) activity in human astroglioma cells
25016017 results support the proposal that cooperative signaling of both NF-kappaB and AP1 (via p38alpha) amplifies STIM1 expression in ECs and, thereby, contributes to the lung vascular hyperpermeability response during sepsis
24987920 By targeting the proto-oncogene Fos, miR-101 is involved in G1-to-S phase transition in cervical cancer cells in vitro.
24909488 The light-induced FOS response in melanopsin expressing HEK-293 cells is correlated with melanopsin quantity and dependent on light duration and irradiance.
24886961 c-Fos, a well known AP-1 transcription factor, has emerged as a unique protein with the capacity to associate to specific enzymes of the pathway of synthesis of phospholipids at the endoplasmic reticulum and activate their synthesis. (Review)
24658403 HIV-1 Tat activates AP-1 (c-Jun/c-Fos) activity in human astroglioma cells
24630741 We found significant negative correlations regarding the expression of the genes COMT, MAOB, DRD4, DRD5 and FOS, indicating that increased schizotypy coincides with higher levels of dopaminergic dysregulation on the mRNA-level.
24551192 HIV-1 Tat activates AP-1 (c-Jun/c-Fos) activity in human astroglioma cells
24479681 the IL-1beta/p38/AP-1(c-fos)/MMP2 & MMP9 pathway play an important role in metastasis in gastric adenocarcinoma
24386331 the distinct requirement of NF-kappaB for mouse and human c-fos regulation
24378831 S100A4, FOS and CXCR4, playing a major role in tumor progression and metastasis, are downregulated by sorafenib.
24322891 c-FOS might influence ovarian cancer progression by changing the adhesion of ovarian cancer cells to peritoneal surfaces
24244375 HIV-1 Tat activates AP-1 (c-Jun/c-Fos) activity in human astroglioma cells
24225433 HIV-1 Tat activates AP-1 (c-Jun/c-Fos) activity in human astroglioma cells
24220339 These findings indicate miR-490-5p to be a novel tumor suppressor of bladder cancer cell proliferation through targeting c-Fos.
24187576 HIV-1 Tat activates AP-1 (c-Jun/c-Fos) activity in human astroglioma cells
24073601 This study indicates that increased expression of c-Fos, p-c-Jun, members of AP-1 transcriptional factor and p-JNK is associated with neuronal degeneration in the ganglion cell layer of retinas in diabetic patients.
23919306 Diminished c-fos expression might play a role in congenital generalized lipodystrophy (CGL) by interfering with adipocyte development.
23844083 Protein kinase R modulates c-Fos and c-Jun signaling to promote proliferation of hepatocellular carcinoma with hepatitis C virus infection.
23760290 Inflammation mediators act through c-Fos to increase VEGF production in peritoneal mesothelium.
23744317 The expression of FOS in glioma was increased and strongly correlated with its pathological grade.
23667255 HBXIP nuclear import requires interaction with c-Fos and phosphorylation of both proteins in breast cancer cells
23660496 In the hippocampus and cerebellum, c-fos expression is decreased in Niemann-Pick type C knock-out mice.
23625206 Data indicate that estrogen induced the expression of c-Jun, Fra-1, c-Fos, cyclin D1 and cyclin E1 while tamoxifen (TMX) decreased the expression.
23625009 gain-of-function mutant cellular c-Jun and c-Fos proteins preferentially bind methylated DNA, which disrupts Epstein-Barr virus latency
23614275 Report c-Fos expression in skin keratinocytes/fibroblasts and keloid fibroblasts exposed to genistein.
23595228 NF-Y performs a diverse set of biological functions, many of which are likely to involve coassociation with FOS.
23593403 This is the first report demonstrating attenuation of stress-induced FOS mRNA stabilization in myelodysplastic syndromes granulocytes.
23578467 C-myc, c-jun and c-fos expression values also showed a time-dependent increase in surviving patients.
23562910 FMR2 is an upstream regulator of FOS and JUN, and further link deregulation of the immediate early response genes to the pathology of ID- and FRAXE-associated ID in particular.
23494858 Down-regulation of c-fos by shRNA sensitizes adriamycin-resistant MCF-7/ADR cells to chemotherapeutic agents via P-glycoprotein inhibition and apoptosis augmentation.
23418787 PRL-3 plays a critical role in ovarian cancer tumorigenicity and maintaining the malignant phenotype. PRL-3 may inhibit c-fos transcriptional regulation of integrin alpha2 signaling.
23400877 we identify a HOXB7/PBX2-->miR-221&222 -->c-FOS regulatory link, whereby the abrogation of functional HOXB7/PBX2 dimers leads to reduced miR-221&222 transcription and elevated c-FOS expression with consequent cell death
23396363 Sumoylation of c-fos could serve to buffer transcriptional actiSumoylation of the c-fos-c-jun complex could serve to buffer transcriptional activation of AP-1 target genes.vation of AP-1 target genes.
23331079 Il-1beta enhances cell migration through AP-1 and NF-kappaB pathway-dependent FGF2 expression in human corneal endothelial cells.
23301044 Fra-1 and c-Fos have roles in supporting growth of human malignant breast tumors by activating membrane biogenesis at the cytoplasm
23209736 cFos mediates cAMP-induced ROS generation, a critical mediator of neutrophil maturation
23135283 PAX2 protein induces expression of cyclin D1 through activating AP-1 protein and promotes proliferation of colon cancer cells.
23121125 There was a significant increase in the expression of the c-Fos gene in endothelial cells incubated with control plasma from 16 and 28 weeks of gestation, with no significant difference between the two time points with plasma from pre-eclampsia cases.
23001723 Derepression of c-Fos caused by miR-139 down-regulation contributes to the metastasis of hepatocellular carcinoma.
22772468 FOS/AP-1 inhibition in SCC cell lines induced p53 expression. Epidermal cell differentiation and skin tumor suppression were caused by a p53-dependent transcriptional activation of the metalloprotease TACE.
22546605 These results suggest that EGF is secreted from A549 cells by MMP and increases claudin-2 expression mediated via the activation of an EGFR/MEK/ERK pathway.
22537850 Protein kinase C stimulates human B cell activating factor gene expression through reactive oxygen species-dependent c-Fos in THP-1 pro-monocytic cells
22534624 Novel cues reinstate responding to a similar extent as conditioned cues, regardless of whether animals have a reinforcement history with cocaine or sucrose; both types of cues activate similar brain circuits.
22528769 The decrease in c-Fos methylation levels might be involved in the early phase of apoptosis induced by NaF in L-02 cells.
22474330 Variation in the expression of c-Fos leads to substantial diversity of IL-2 expression in approximately 40% of the memory Th cells
22354777 When the histone H3 nonphosphorylatable mutant of serine 10 (S10A) was overexpressed in cells, arsenite induction of FOS, EGR1 and IL8 expression was significantly decreased as compared with wild-type cells.
22308434 EVI1 is a multipurpose transcription factor that synergizes with FOS in invasive tumors.
22108803 results suggest that, in addition to the indirect mechanisms that appear to mediate the antiproliferative properties of 1,25-(OH)2D3 in colorectal cancer cells, the hormone also exerts direct effects on both c-FOS and c-MYC
22105363 c-Src is capable of phosphorylating tyr residues of c-Fos whereas the phosphatase TC45 T-cell protein-tyr phosphatase (TC-PTP) dephosphorylates them
22077140 HIV-1 Tat activates AP-1 (c-Jun/c-Fos) activity in human astroglioma cells
22076613 A novel TF/FVIIa/MAPK/c-Fos/MMP-7 axis plays an important role in modulating the invasion of colon cancer cells.
21978922 c-Fos transcript levels in blood leukocytes could be considered as a cumulative biomarker of smoking in coronary artery disease.
21975339 High C-fos is associated with rectal cancer.
21920361 c-Fos acts as a positive regulator of HCV propagation and may contribute to HCV-associated pathogenesis.
21822357 Data show that HPV16E6-dependent c-fos oncogenic protein expression contributes to AP-1 complex formation under oxidative stress in SiHa cells.
21757709 AP-1-dependent up-regulation of the P2 promoter, SLE T cells fail to further increase their basal CREM levels upon T cell activation due to a decreased content of the AP-1 family member c-Fos
21732357 Results suggest that IL-3 plays an inhibitory role in osteoclast differentiation by regulating c-Fos and Id1, and also exerts anti-bone erosion effects.
21655091 Genome-wide analysis reveals PADI4 cooperates with Elk-1 to activate c-Fos expression in breast cancer cells
21607373 HIV-1 Tat activates AP-1 (c-Jun/c-Fos) activity in human astroglioma cells
21496208 an intricate network of energetically-coupled residues within the basic regions of the Jun-Fos heterodimeric transcription factor accounts for its allosteric binding to DNA
21496113 PPAR-delta agonists inhibit TGFalpha-induced MMP9 expression in human keratinocytes. This inhibition involves repression of c-fos binding at the MMP9 promoter.
21423810 HIV-1 Tat activates AP-1 (c-Jun/c-Fos) activity in human astroglioma cells
21385848 silencing of c-Fos expression by miR155 is a conserved process that is required for dendritic cell maturation and function
21340718 Elevated expression of c-fos in CNS might be one of key mechanisms in etiology of irritable bowel syndrome.
21303932 CEBPbeta, CYP1B1, and FOS mRNA and protein expression was increased in Pulmonary Artery Smooth Muscle Cellss derived from pulmonary arterial hypertension patients.
21106746 results demonstrating dispensability of enhancer AP-1 binding motifs in infectious life cycle of cytomegalovirus and its compensation through NF-kappaB elements evidence functional robustness of major immediate-early enhancer regulation by host factors
21034562 HIV-1 Tat activates AP-1 (c-Jun/c-Fos) activity in human astroglioma cells
20976196 A novel role of the surface protease GP63 in the Leishmania-mediated subversion of host AP-1 activity.
20869948 HIV-1 Tat activates AP-1 (c-Jun/c-Fos) activity in human astroglioma cells
20726226 Polypeptide from Chlamys farreri could attenuate UVA-induced Fas and c-fos expression, which may attribute to its protective effect against UVA-induced damage in HaCaT cells.
20682178 patients with positive c-fos expression in gastric tumor epithelia had significantly prolonged overall and tumor-free survival
20628624 Meta-analysis of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20619839 FOS mRNA levels appear to be a sensitive marker of statin treatment that is dissociated from cholesterol levels
20531301 Inhibition of AP-1 by SARI negatively regulates transformation progression mediated by CCN1.
20503287 Observational study of gene-disease association. (HuGE Navigator)
20493519 Results show that a coherent feedforward loop signaling cascade interlinked with transcriptional negative feedback loops is the c-Fos regulation module wherein differential, spatially distributed ERK dynamics contribute to binary cell-fate decisions.
20468064 Observational study of gene-disease association. (HuGE Navigator)
20463008 These data identify atypical PKC isozymes as STAT and ERK activators that mediate c-fos and collagenase expression.
20459032 Acrylamide can induce high protein expressions of c-fos and c-jun proto-oncogenes and apoptosis in L-02 cells.
20209053 cytoplasmic c-Fos has a role as an activator of phospholipid synthesis
20203690 Binding of G-1 compound to GPR30 in PC-3 prostate cancer cells is followed by sustained activation of Erk1/2 and a c-jun/c-fos-dependent upregulation of p21, resulting in the arrest of PC-3 growth at the G(2) phase.
20089855 CREB controls MSK1-mediated phosphorylation of histone H3 at the c-fos promoter in vitro
20012528 HIV-1 Tat activates AP-1 (c-Jun/c-Fos) activity in human astroglioma cells
19959471 Studies present the first evidence demonstrating the role of the AP-1 complex in transcriptional down-regulation of the p27(Kip1) gene following mitogenic stimulation.
19937979 Up-regulation of TRPM6 transcriptional activity by AP-1 in renal epithelial cells.
19921846 Jun-Fos heterodimer exhibits differential energetics in binding to genetic variants of TGACGTCA canonical motif.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19874574 Observational study of gene-disease association. (HuGE Navigator)
19859790 c-Jun-NH2 terminal kinase (JNK)-mediates AP-1 activation by thioredoxin.
19795350 Expression of the proto-oncogene C-FOS and the immunolocalization of C-FOS, phosphorylated C-FOS in the testis are reported.
19714312 Results established that GATA2 and c-Jun/c-Fos act additively in modulating the SIRT3-VNTR enhancer function.
19692168 Observational study of gene-disease association. (HuGE Navigator)
19625176 Observational study of gene-disease association. (HuGE Navigator)
19581295 HNRNPR enhanced transcription from the c-fos promoter.
19557575 Report FOS proliferating network construction in early colorectal cancer (CRC) based on integrative significant function cluster and inferring analysis.
19513521 AP-1 proteins (jun/fos) are differentially expressed in ovarian tumors of differing malignant potential. No correlation with the proliferative and invasive potential of ovarian cancer cell lines could be found.
19495976 H. pylori in a Korean isolate induces the expression of COX-2 and iNOS via AP-1 activation, which may be mediated by Ras and the expression of c-Fos and c-Jun in gastric epithelial cells.
19453261 Observational study of gene-disease association. (HuGE Navigator)
19384981 study found surface parameters for Fra-1 are similar in general to those of c-Fos and c-Jun; differences were found in the interactions of the three proteins with phospholipids
19329434 Promoter analysis showed that PRIP acted through serum-responsive factor to regulate FOS gene expression.
19299513 Trolox prevents osteoclast formation and bone loss by inhibiting both RANKL induction in osteoblasts and c-Fos expression in osteoclast precursors.
19269029 the role of calmodulin in PACAP-induced FOS gene expression
19258923 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19215067 Data suggest that the single nucleotide variants of the TGACTCA motif modulate energetics and orientation of binding of the Jun-Fos heterodimer and that such behavior may be a critical determinant of differential regulation of specific genes.
19199093 Data suggest that c-fos may play a role in the molecular mechanisms of estrogen action on the induction, promotion or progression of endometriosis.
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19151755 confirmed the downregulation of the FOS-JUNB pathway at transcriptional and protein level
19135542 c-Fos is a requisite and specific component for inducible NOS2 expression
19105933 PDGF and TGF beta can strongly up-regulate c-fos and c-jun gene expressions in hepatic stellate T6 cells.
19028685 The SAF-1.c-Fos.c-Jun ternary complex efficiently promotes transcription from both SAF-1 and AP-1 sites of human MMP-1 promoter.
19022561 both SF1 and LRH1 can transcriptionally cooperate with the AP-1 family members c-JUN and c-FOS, known to be associated with enhanced proliferation of endometrial carcinoma cells, to further enhance activation of the STAR, HSD3B2, and CYP19A1 PII promoters
19015316 Fast regulation of AP-1 activity through interaction of lamin A/C, ERK1/2, and c-Fos at the nuclear envelope.
19013323 HIV-1 Tat activates AP-1 (c-Jun/c-Fos) activity in human astroglioma cells
19009649 c-Fos overexpression increases the proliferation of human hepatocytes by stabilizing nuclear Cyclin D1.
18986987 the enhanced ability of tumor-derived LMP1 to induce and stabilize the c-Fos oncogene can be localized to two amino acids in the C terminus of LMP1
18957410 bexarotene increased the occupancy of the identified enhancer element in IGFBP-6 gene by RXRalpha, RARbeta, cJun, cFos, and p300
18923650 Peptidylarginine deiminase Intergenic Enhancer is a strong enhancer of the PADI3 promoter in Ca2+-differentiated epidermal keratinocytes, and requires bound
18854825 loss of c-Fos expression is associated with tumour progression in ovarian carcinoma and that c-Fos may be a prognostic factor
18838675 identify c-JUN and c-FOS as important regulators of human replication origin selection
18826606 FOS-related genes, which have been implicated in early hypoxia as well as the development of breast cancers, were differentially expressed before and after surgery.
18802113 Overexpression experiments implicate AP-1 family member Fra-1 in regulation of matrix metalloproteinase-1 expression in myeloid cells during inflammation.
18725194 The thermodynamics of heterodimerization of leucine zippers of Jun and Fos was characterized.
18676680 Observational study of gene-disease association. (HuGE Navigator)
18653705 Activator protein-1 and smad proteins synergistically regulate human follicle-stimulating hormone beta-promoter activity.
18644870 Results describe the effects of estradiol on cyclin D1, PS2, and c-fos gene expression by measuring levels of RNA polymerase II on DNA templates, levels of nascent transcripts associated with RNA polymerase II, and levels of RNAs.
18641127 FRA2 and AP1 have roles in development of pulmonary fibrosis
18621151 LPS-induced c-fos and c-jun expressions are mediated by two different signaling pathways: one through phosphoinositide-phospholipase C, and the second through activation of protein kinase A (PKA).
18599327 These results indicate that the rat model shows symptoms similar to those in patients with orofacial cancer, for example, induction of feeding disorder and neuropathic pain.
18597608 Thrombin also stimulated the expression of c-fos in GFs within 1 hour of exposure. The stimulation of c-fos mRNA expression by thrombin can be attenuated by D-Phe-Pro-ArgCH(2)Cl, a serine-proteinase inhibitor.
18500346 an unexpected function for c-Fos as a direct regulator of Tcrb recombination, rather than its usual function as a transcription regulator.
18467434 GPR30-mediated inhibition of urothelial cell proliferation is the result of decreased cyclin D1 by down-regulation of activation protein-1 signaling.
18425349 Results suggest that ganoderic acids-A and -H mediate their biological effects through the inhibition of AP-1 and NF-kappaB, resulting in the down-regulation of expression of Cdk4 and the suppression of secretion of uPA, respectively.
18422165 The c-fos and c-myc expression was remarkably downregulated in nasal polyps from topical steroid treated patients compared to untreated patients.
18405916 These data demonstrate the role of Cx43 in the proliferation and migration of human saphenous vein smooth muscle cells and angiotensin II-induced Cx43 expression via mitogen-activated protein kinases (MAPK)-AP-1 signaling pathway.
18368600 The present data indicate that bovine dialyzable leukocyte extract can block the AP-1 DNA-binding activity and expression of several transcriptions factors in breast cancer cells.
18316037 Binding of Fos-Jun bZIP domains to both tetradecanoylphorbol acetate (TRE) and CRE response elements is under enthalpic control and accompanied by entropic penalty at physiological temperatures.
18309110 The physical interaction of AP-1 with p22(phox) gene promoter facilitates NADPHox regulation.
18305042 vFLIP suppresses the AP-1 pathway, which is essential for KSHV lytic replication, by activating the NF-kappaB pathway.
18283312 AP-1 plays an essential role in the growth of at least some of NSCLC cells.
18252863 These results suggest that promotion of endothelial migration and proliferation by Ang-1 is mediated, in part, through the production of IL-8, which acts in an autocrine fashion to suppress apoptosis and facilitate cell proliferation and migration.
18206243 These results demonstrated that D-alpha-tocopherol may be able to prevent the IL-8 upregulation and the increase in AP-1 activation induced by UVA irradiation through down-modulating cellular oxidative stress.
18158562 A loss of c-fos expression is correlated with a more advanced stage, lymph node metastasis, lymphatic invasion and shorter survival in gastric carcinoma.
18097055 HIV-1 Tat activates AP-1 (c-Jun/c-Fos) activity in human astroglioma cells
18042260 HIV-1 Tat activates AP-1 (c-Jun/c-Fos) activity in human astroglioma cells
18032824 VEGF, p-IkappaB-alpha, NF-kappaB, c-FOS, p-c-JUN, EGF-R and COX-2 were expressed in stromal myofibroblasts surrounding colon adenocarcinomas in the majority of cases.
17926144 c-Fos may undergo cell cycle dependent phosphorylation, in which some kinases including Aurora-A play a role in catalyzing the post translational modification of c-Fos.
17915561 During mitosis, HSF2 is bound to the HSE promoter elements of other heat shock genes, including hsp90 and hsp27, and the proto-oncogene c-fos. The presence of HSF2 is important for expression of these genes.
17888430 Expression of c-fos in the human endometrium may be regulated by 17beta-E(2), and c-fos may be involved in development of endometriosis by promoting MMP-9 gene expression and subsequently the invasive potential of endometrial explants.
17703412 Observational study of gene-disease association. (HuGE Navigator)
17681951 Dimerization with the Jun proteins inhibits c-Fos nuclear exit.
17639289 Ras/MAPK cascade acts as the upstream signaling for AP-1 activation and IL-8 expression in toxin A-stimulated intestinal epithelial cells.
17636030 Amino acid residues required for physical and cooperative transcriptional interaction of STAT3 and AP-1 proteins c-Jun and c-Fos.
17606925 c-fos expression in the medial geniculate body triggered by cortical activation is elicited via a direct corticothalamic pathway, not by the pathway through the thalamic reticular nucleus.
17549045 In the paraventricular nucleus anandamide and N-arachidonoyl-serotonin increased significantly c-Fos expression. In the arcuate nucleus only OMDM-1 increased c-Fos expression.
17495958 Coordinated down- and up-regulation of the various AP-1 subunits in the course of epidermal wound healing is important for its undisturbed progress, putatively by influencing inflammation and cell-cell communication.
17235455 These data indicate that the aberrant expression of PTEN contributes to the activation of the PI3kinase/Akt pathway and its transcription factor mediators in glioma.
17209045 RET(Y791F) and RET(S891A) induce STAT3 Ser(727) phosphorylation via a canonical Ras/ERK1/2 pathway and integration of the Ras/ERK1/2/ELK-1 and STAT3 pathways was required for up-regulation of the c-fos promoter by FMTC-RET
17182779 c-Fos produced in D1 receptor-expressing neurons integrates mechanisms to facilitate both the acquisition and extinction of cocaine-induced persistent changes in brains of Drd-1-Cre transgenic mice.
17160021 phosphorylation of tyrosine residues 10 and 30 of c-Fos regulate the rate of synthesis of phospholipids by regulating c-Fos/endoplasmic reticulum association.
17080554 Results suggest that EGCG may have an inhibitory effect on UVB-induced photo-damage and apoptosis by blocking the cytokine secretion and the mRNA expressions of p53, p21 and c-fos genes.
17018293 Sustained ERK5 activity and the E3 ligase UBR1 regulate the stability and subcellular localization of c-Fos.
16828227 The increase in c-Fos-immunoreactive neurons induced by butyric acid was reproduced with hydrochloric acid at the same pH but not with sodium butyrate.
16690925 HIV-1 Tat activates AP-1 (c-Jun/c-Fos) activity in human astroglioma cells
16637060 c-Fos binding at the TGFbeta1 promoter proximal AP-1 site in human colon carcinoma cells is required for TGFbeta1 production by the tumor cells.
16552729 Results showed that certain regulation involved in c-myc, c-fos, and c-jun was present in the apoptosis, and the c-Myc dependent-on and Jun N-terminal kinase (JNK) pathway also play roles.
16243842 HIV-1 Tat activates AP-1 (c-Jun/c-Fos) activity in human astroglioma cells
16219292 INI1/hSNF5/BAF47 could be recruited to the region of c-fos promoter to reduce histone acetylation
16123044 c-Fos represents a novel target for the isomerizing activity of Pin1, which has a role in the mechanism by which c-Jun and c-Fos cooperate to regulate AP-1-dependent gene transcription
16055710 c-Fos/c-Jun AP-1 dimer activity is downregulated by SUMO-1, SUMO-2, and SUMO-3
16049073 activity of the AP-1 components c-Jun, ATF2, and c-Fos is altered in renal cystic tissue of patients with autosomal dominant polycystic kidney disease
16038047 PGE2 increases the expression and secretion of VEGF in HCC cells by activating the transcription factor c-fos, promotes the angiogenesis of hepatocellular carcinoma and plays an important role in the pathogenesis of liver cancer.
16001969 HIV-1 Tat activates AP-1 (c-Jun/c-Fos) activity in human astroglioma cells
15926923 In hepatoma-associated anorexia-cachexia c-Fos was induced in several brain areas of thes forebrain.
15921770 Vasoactive intestinal peptide induces FOS expression in a prostatic neoplasm cell line.
15844599 No statistical significances of p73 or c-fos expressions were observed between involutional hemangioma and normal skin.
15835820 bFGF induces the increased expression of c-fos through PI 3-K/PKB in CNE- I nasopharyngeal carcinoma cell line.
15767669 TBP affects the NF1 and c-fos promoters in a manner reciprocal to that of TLF, stimulating the c-fos promoter and inhibiting NF1 transcription
15708845 p38alpha and -beta mediate UV-induced, AP-1-mediated, c-Fos phosphorylation
15654976 In psoriatic epidermis, c-Jun expression was prominent in both hyperproliferating basal and suprabasal keratinocytes, whereas c-Fos expression was unchanged.
15588513 SDF-1/CXCL12 enhanced cell survival in synergy with other cytokines involves activation of CREB and induction of Mcl-1 and c-Fos
15548518 loss of Net and constitutive c-fos expression appear to be a key event in the transformation of cervical cancer cells.
15507668 c-jun, junD, junB, and c-fos and Notch2 are expressed in splenic marginal zone lymphoma
15262961 AP-1 and JNK have roles in reactive oxygen species activation in tobacco-induced mucin production in lung cells
15258149 HIV-1 Tat activates AP-1 (c-Jun/c-Fos) activity in human astroglioma cells
15188457 FOS is the primary target of up-regulation in Helicobacter pylori infections in human gastric cancer cells.
14966901 expression of Egr-1, c-fos and cyclin D1 varies in esophageal precancerous lesions and cancer tissues, suggesting an involvement of these genes in the development of esophageal carcinoma.
14741347 VEGF and PlGF induced expression of both full-length FosB mRNA and an alternatively spliced variant.
14727154 Observational study of gene-disease association. (HuGE Navigator)
14629301 The positive c-fos immunoreactivity observed in sudden infant death syndrome suggests that the neurons of the dorsal motor vagal nucleus involved in the regulation of breathing are able to yield an intense, immediate ventilatory response to hypoxia.
14517309 c-Fos proto-oncoprotein is degraded by the proteasome independently of its own ubiquitinylation
14511403 c-fos and AP-1 are regulated by JNK and p38 MAPK
12972619 Phosphorylation of the carboxy-terminal transactivation domain of c-FGOS by extracellular signal-related kinase mediates the transcriptional activation of AP-1 and cellular neoplastic transformation by PDGF.
12788789 a physical interaction between c-Fos and STAT-1 participates in NOS2 gene transcriptional activation in lung epithelium
12705898 Up-regulation of c-Fos in the lymphocytes of rheumatoid arthritis patients.
12692226 data demonstratre that c-Fos physically and functionally interacts with JCV major early regulatory protein large T-Ag and that this interaction modulates JCV transcription and replication in glial cells
12687275 p53 and c-fos are significantly overexpressed in thyroid cancer patients, indicating their role in the genetic mechanisms leading to thyroid tumorigenesis
12600988 independent and cooperative activation of chromosomal c-fos promoter by STAT3
12592382 Expression of c-fos was induced by TPA and Saikosaponin a during 30 min to 6 h of treatment.
12547826 Tumor promoter arsenite stimulates histone H3 phosphoacetylation of this and c-jun proto-oncogene chromatin in diploid fibroblasts.
12446585 studies suggest that the cooperative interaction of the estrogen receptor with Fos and Jun proteins helps confer estrogen responsiveness to the endogenous progesterone receptor gene
12445807 results suggest that Hic-5 participates in the transcriptional regulation of c-fos as a scaffold in transcriptional complexes
12419805 HIV-1 Tat activates AP-1 (c-Jun/c-Fos) activity in human astroglioma cells
12183893 Review. AP1 plays a crucial role during human papillomavirus (HPV) early gene expression, in particular of the expression of E6 and E7 oncoproteins.
12147741 candidate genes that may be involved in the origination of ameloblastoma and several genes previously unidentified in relation to human tooth development.
12082260 Effects of fluid shear stress on expression of proto-oncogenes c-fos and c-myc in cultured human umbilical vein endothelial cells.
11909859 Analysis of heterophilic and homophilic interactions of cadherins using the c-Jun/c-Fos dimerization domains
11891317 Bombesin antagonists inhibit growth of MDA-MB-435 estrogen-independent breast cancers and decrease the expression of the ErbB-2/HER-2 oncoprotein and c-jun and c-fos oncogenes
11846562 Crystal structure of a ternary SAP-1/SRF/c-fos SRE DNA complex
11260070 HIV-1 Tat activates AP-1 (c-Jun/c-Fos) activity in human astroglioma cells
10799874 HIV-1 Tat activates AP-1 (c-Jun/c-Fos) activity in human astroglioma cells
10581001 HIV-1 Tat activates AP-1 (c-Jun/c-Fos) activity in human astroglioma cells
10388555 HIV-1 Tat activates AP-1 (c-Jun/c-Fos) activity in human astroglioma cells
10027715 HIV-1 Tat activates AP-1 (c-Jun/c-Fos) activity in human astroglioma cells
9129988 HIV-1 Tat activates AP-1 (c-Jun/c-Fos) activity in human astroglioma cells
9057648 HIV-1 Tat activates AP-1 (c-Jun/c-Fos) activity in human astroglioma cells
8621941 HIV-1 Tat activates AP-1 (c-Jun/c-Fos) activity in human astroglioma cells
8480425 HIV-1 Tat activates AP-1 (c-Jun/c-Fos) activity in human astroglioma cells
8151786 HIV-1 Tat activates AP-1 (c-Jun/c-Fos) activity in human astroglioma cells
7957556 HIV-1 Tat activates AP-1 (c-Jun/c-Fos) activity in human astroglioma cells
7642615 HIV-1 Tat activates AP-1 (c-Jun/c-Fos) activity in human astroglioma cells

AA Sequence

MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDFCTDLAVSSANFIPTVTAISTS      1 - 70
PDLQWLVQPALVSSVAPSQTRAPHPFGVPAPSAGAYSRAGVVKTMTGGRAQSIGRRGKVEQLSPEEEEKR     71 - 140
RIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQTEIANLLKEKEKLEFILAAHRPACKIPDDL    141 - 210
GFPEEMSVASLDLTGGLPEVATPESEEAFTLPLLNDPEPKPSVEPVKSISSMELKTEPFDDFLFPASSRP    211 - 280
SGSETARSVPDMDLSGSFYAADWEPLHSGSLGMGPMATELEPLCTPVVTCTPSCTAYTSSFVFTYPEADS    281 - 350
FPSCAAAHRKGSSSNEPSSDSLSSPTLLAL                                            351 - 380
//

Text Mined References (313)

PMID Year Title
26988982 2016 IL-17 mediates inflammatory reactions via p38/c-Fos and JNK/c-Jun activation in an AP-1-dependent manner in human nucleus pulposus cells.
26858249 2016 Inhibitor of Differentiation/DNA Binding 1 (ID1) Inhibits Etoposide-induced Apoptosis in a c-Jun/c-Fos-dependent Manner.
26631725 2016 Purinergic P2Y2 Receptor Control of Tissue Factor Transcription in Human Coronary Artery Endothelial Cells: NEW AP-1 TRANSCRIPTION FACTOR SITE AND NEGATIVE REGULATOR.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26493679 2016 CREB, AP-1, ternary complex factors and MAP kinases connect transient receptor potential melastatin-3 (TRPM3) channel stimulation with increased c-Fos expression.
26381409 2015 The RNA binding complexes NF45-NF90 and NF45-NF110 associate dynamically with the c-fos gene and function as transcriptional coactivators.
26303532 2015 Evidence for Homodimerization of the c-Fos Transcription Factor in Live Cells Revealed by Fluorescence Microscopy and Computer Modeling.
26209639 2015 Interleukin-1 Receptor Type 2 Acts with c-Fos to Enhance the Expression of Interleukin-6 and Vascular Endothelial Growth Factor A in Colon Cancer Cells and Induce Angiogenesis.
26173738 2015 Fusion events lead to truncation of FOS in epithelioid hemangioma of bone.
26112171 2015 miR-146a targets Fos expression in human cardiac cells.
26018080 2015 Interplay between TAp73 Protein and Selected Activator Protein-1 (AP-1) Family Members Promotes AP-1 Target Gene Activation and Cellular Growth.
25903346 2015 ORF45-Mediated Prolonged c-Fos Accumulation Accelerates Viral Transcription during the Late Stage of Lytic Replication of Kaposi's Sarcoma-Associated Herpesvirus.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25706621 2015 Schizophrenia-associated Risk and Protective Variants of c-Fos Encoding Gene.
25670814 2015 O-GlcNAcylation of MLL5? is essential for MLL5?-AP-1 transcription complex assembly at the HPV16/18-long control region.
25647783 2015 ERK1/2 promoted proliferation and inhibited apoptosis of human cervical cancer cells and regulated the expression of c-Fos and c-Jun proteins.
25609649 2015 Proteomic analyses reveal distinct chromatin-associated and soluble transcription factor complexes.
25588078 2015 An interplay between the p38 MAPK pathway and AUBPs regulates c-fos mRNA stability during mitogenic stimulation.
25544773 2015 Targeting the microRNA-21/AP1 axis by 5-fluorouracil and pirarubicin in human hepatocellular carcinoma.
25384976 2015 Cyclin-dependent kinase 12 increases 3' end processing of growth factor-induced c-FOS transcripts.
25241761 2014 Using an in situ proximity ligation assay to systematically profile endogenous protein-protein interactions in a pathway network.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25157104 2014 Nuclear matrix protein SMAR1 represses c-Fos-mediated HPV18 E6 transcription through alteration of chromatin histone deacetylation.
25077945 2014 Endoplasmic reticulum stress activates the hepatic activator protein 1 complex via mitogen activated protein kinase-dependent signaling pathways.
25016017 2014 Cooperative signaling via transcription factors NF-?B and AP1/c-Fos mediates endothelial cell STIM1 expression and hyperpermeability in response to endotoxin.
24987920 2014 miR-101 inhibits the G1-to-S phase transition of cervical cancer cells by targeting Fos.
24909488 The light-induced FOS response in melanopsin expressing HEK-293 cells is correlated with melanopsin quantity and dependent on light duration and irradiance.
24886961 2014 c-Fos: an AP-1 transcription factor with an additional cytoplasmic, non-genomic lipid synthesis activation capacity.
24630741 2014 Psychosis-proneness correlates with expression levels of dopaminergic genes.
24479681 2014 IL-1?-induced activation of p38 promotes metastasis in gastric adenocarcinoma via upregulation of AP-1/c-fos, MMP2 and MMP9.
24386331 2013 Regulation of c-Fos gene expression by NF-?B: a p65 homodimer binding site in mouse embryonic fibroblasts but not human HEK293 cells.
24378831 2014 Human osteosarcoma cells respond to sorafenib chemotherapy by downregulation of the tumor progression factors S100A4, CXCR4 and the oncogene FOS.
24322891 2014 c-FOS suppresses ovarian cancer progression by changing adhesion.
24220339 2013 MicroRNA-490-5p inhibits proliferation of bladder cancer by targeting c-Fos.
24184327 2014 Mitochondrial impairment increases FL-PINK1 levels by calcium-dependent gene expression.
24073601 2014 Increased expression of c-Fos, c-Jun and c-Jun N-terminal kinase associated with neuronal cell death in retinas of diabetic patients.
24029232 2013 Protein kinase C ? is a central signaling node and therapeutic target for breast cancer stem cells.
23919306 2013 A mutation in the c-fos gene associated with congenital generalized lipodystrophy.
23844083 2013 Protein kinase R modulates c-Fos and c-Jun signaling to promote proliferation of hepatocellular carcinoma with hepatitis C virus infection.
23760290 2013 The proto-oncogene c-Fos transcriptionally regulates VEGF production during peritoneal inflammation.
23744317 2013 [Expression of FOS protein in glioma and its effect on the growth of human glioma cells].
23667255 2013 The nuclear import of oncoprotein hepatitis B X-interacting protein depends on interacting with c-Fos and phosphorylation of both proteins in breast cancer cells.
23660496 2013 Changes of calcium binding proteins, c-Fos and COX in hippocampal formation and cerebellum of Niemann-Pick, type C mouse.
23625206 2013 Effect of estrogen and tamoxifen on the expression pattern of AP-1 factors in MCF-7 cells: role of c-Jun, c-Fos, and Fra-1 in cell cycle regulation.
23625009 2013 Latency of Epstein-Barr virus is disrupted by gain-of-function mutant cellular AP-1 proteins that preferentially bind methylated DNA.
23614275 Influence of genistein on c-Jun, c-Fos and Fos-B of AP-1 subunits expression in skin keratinocytes, fibroblasts and keloid fibroblasts cultured in vitro.
23602568 2013 The protein interaction landscape of the human CMGC kinase group.
23595228 2013 NF-Y coassociates with FOS at promoters, enhancers, repetitive elements, and inactive chromatin regions, and is stereo-positioned with growth-controlling transcription factors.
23593403 2013 Impairment of FOS mRNA stabilization following translation arrest in granulocytes from myelodysplastic syndrome patients.
23578467 2013 Early cell-cycle gene expression in T-cells after hematopoietic stem cell transplantation.
23562910 2013 Loss of FMR2 further emphasizes the link between deregulation of immediate early response genes FOS and JUN and intellectual disability.
23494858 2013 Down-regulation of c-fos by shRNA sensitizes adriamycin-resistant MCF-7/ADR cells to chemotherapeutic agents via P-glycoprotein inhibition and apoptosis augmentation.
23418787 2013 PRL-3 suppresses c-Fos and integrin ?2 expression in ovarian cancer cells.
23400877 2013 The abrogation of the HOXB7/PBX2 complex induces apoptosis in melanoma through the miR-221&222-c-FOS pathway.
23396363 2014 SUMOylation of the inducible (c-Fos:c-Jun)/AP-1 transcription complex occurs on target promoters to limit transcriptional activation.
23331079 2013 Interleukin-1? enhances cell migration through AP-1 and NF-?B pathway-dependent FGF2 expression in human corneal endothelial cells.
23301044 2013 Old players with a newly defined function: Fra-1 and c-Fos support growth of human malignant breast tumors by activating membrane biogenesis at the cytoplasm.
23209736 2012 cFos mediates cAMP-dependent generation of ROS and rescue of maturation program in retinoid-resistant acute promyelocytic leukemia cell line NB4-LR1.
23135283 2012 PAX2 protein induces expression of cyclin D1 through activating AP-1 protein and promotes proliferation of colon cancer cells.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
23121125 2012 Endothelial FOS expression and pre-eclampsia.
23001723 2013 Derepression of c-Fos caused by microRNA-139 down-regulation contributes to the metastasis of human hepatocellular carcinoma.
22772468 2012 Differentiation-induced skin cancer suppression by FOS, p53, and TACE/ADAM17.
22699663 2012 Genome-wide association study of periodontal pathogen colonization.
22546605 2012 Increase in claudin-2 expression by an EGFR/MEK/ERK/c-Fos pathway in lung adenocarcinoma A549 cells.
22537850 2012 Protein kinase C stimulates human B cell activating factor gene expression through reactive oxygen species-dependent c-Fos in THP-1 pro-monocytic cells.
22534624 2012 Novel cues reinstate cocaine-seeking behavior and induce Fos protein expression as effectively as conditioned cues.
22528769 2012 The effect of c-Fos demethylation on sodium fluoride-induced apoptosis in L-02 cells.
22474330 2012 Stable IL-2 decision making by endogenous c-Fos amounts in peripheral memory T-helper cells.
22354777 2013 Phosphorylation of histone H3 at serine 10 has an essential role in arsenite-induced expression of FOS, EGR1 and IL8 mRNA in cultured human cell lines.
22308434 2012 Ecotopic viral integration site 1 (EVI1) regulates multiple cellular processes important for cancer and is a synergistic partner for FOS protein in invasive tumors.
22108803 2012 VDR/RXR and TCF4/?-catenin cistromes in colonic cells of colorectal tumor origin: impact on c-FOS and c-MYC gene expression.
22105363 2012 The kinase c-Src and the phosphatase TC45 coordinately regulate c-Fos tyrosine phosphorylation and c-Fos phospholipid synthesis activation capacity.
22076613 2012 Tissue factor/activated factor VIIa induces matrix metalloproteinase-7 expression through activation of c-Fos via ERK1/2 and p38 MAPK signaling pathways in human colon cancer cell.
21978922 2011 Smoking and FOS expression from blood leukocyte transcripts in patients with coronary artery disease.
21975339 2011 Molecular changes consistent with increased proliferation and invasion are common in rectal cancer.
21920361 2011 c-Fos regulates hepatitis C virus propagation.
21822357 2011 HPV16E6-dependent c-fos expression contributes to AP-1 complex formation in SiHa cells.
21757709 2011 A novel intronic cAMP response element modulator (CREM) promoter is regulated by activator protein-1 (AP-1) and accounts for altered activation-induced CREM expression in T cells from patients with systemic lupus erythematosus.
21732357 2012 Inhibitory regulation of osteoclast differentiation by interleukin-3 via regulation of c-Fos and Id protein expression.
21655091 2011 Genome-wide analysis reveals PADI4 cooperates with Elk-1 to activate c-Fos expression in breast cancer cells.
21496208 2011 Energetic coupling along an allosteric communication channel drives the binding of Jun-Fos heterodimeric transcription factor to DNA.
21496113 2011 AP1-dependent repression of TGF?-mediated MMP9 upregulation by PPAR? agonists in keratinocytes.
21385848 2011 Silencing of c-Fos expression by microRNA-155 is critical for dendritic cell maturation and function.
21340718 2011 Elevated expression of c-fos in central nervous system correlates with visceral hypersensitivity in irritable bowel syndrome (IBS): a new target for IBS treatment.
21303932 2011 Serotonin transporter, sex, and hypoxia: microarray analysis in the pulmonary arteries of mice identifies genes with relevance to human PAH.
21199371 2011 Thermodynamic analysis of Jun-Fos coiled coil peptide antagonists.
21106746 2011 The activator protein 1 binding motifs within the human cytomegalovirus major immediate-early enhancer are functionally redundant and act in a cooperative manner with the NF-{kappa}B sites during acute infection.
20976196 2010 Leishmania-induced inactivation of the macrophage transcription factor AP-1 is mediated by the parasite metalloprotease GP63.
20936779 2010 A human MAP kinase interactome.
20726226 2010 [Effect of polypeptide from Chlamys farreri on ultraviolet A-induced Fas and c-fos expression in HaCaT cells].
20682178 2010 Negative association of c-fos expression as a favorable prognostic indicator in gastric cancer.
20628624 2010 Evaluation of candidate stromal epithelial cross-talk genes identifies association between risk of serous ovarian cancer and TERT, a cancer susceptibility "hot-spot".
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20619839 2010 FOS expression in blood as a LDL-independent marker of statin treatment.
20531301 2010 Inhibition of AP-1 by SARI negatively regulates transformation progression mediated by CCN1.
20511396 2010 In situ proximity ligation detection of c-Jun/AP-1 dimers reveals increased levels of c-Jun/Fra1 complexes in aggressive breast cancer cell lines in vitro and in vivo.
20503287 2010 Interleukin-9 polymorphism in infants with respiratory syncytial virus infection: an opposite effect in boys and girls.
20493519 2010 Ligand-specific c-Fos expression emerges from the spatiotemporal control of ErbB network dynamics.
20468064 2010 Association study of 182 candidate genes in anorexia nervosa.
20463008 2010 Protein kinase C isoforms zeta and iota mediate collagenase expression and cartilage destruction via STAT3- and ERK-dependent c-fos induction.
20459032 2010 [Effects of acrylamide on the protein expressions of c-fos and c-jun proto-oncogenes in cell L-02].
20209053 2010 Growth of peripheral and central nervous system tumors is supported by cytoplasmic c-Fos in humans and mice.
20203690 2010 Activation of GPR30 inhibits the growth of prostate cancer cells through sustained activation of Erk1/2, c-jun/c-fos-dependent upregulation of p21, and induction of G(2) cell-cycle arrest.
20195357 2010 A comprehensive resource of interacting protein regions for refining human transcription factor networks.
20102225 2010 Identification of bZIP interaction partners of viral proteins HBZ, MEQ, BZLF1, and K-bZIP using coiled-coil arrays.
20089855 2010 cAMP-response element-binding protein (CREB) controls MSK1-mediated phosphorylation of histone H3 at the c-fos promoter in vitro.
19959471 2010 Mitogenic regulation of p27(Kip1) gene is mediated by AP-1 transcription factors.
19937979 2010 Up-regulation of TRPM6 transcriptional activity by AP-1 in renal epithelial cells.
19921846 2009 DNA plasticity is a key determinant of the energetics of binding of Jun-Fos heterodimeric transcription factor to genetic variants of TGACGTCA motif.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19874574 2009 Genetical genomic determinants of alcohol consumption in rats and humans.
19859790 2010 c-Jun-NH2 terminal kinase (JNK)-mediates AP-1 activation by thioredoxin: phosphorylation of cJun, JunB, and Fra-1.
19795350 2009 Expression of the proto-oncogene c-fos and the immunolocalization of c-fos, phosphorylated c-fos and estrogen receptor beta in the human testis.
19714312 2009 Identification of GATA2 and AP-1 Activator elements within the enhancer VNTR occurring in intron 5 of the human SIRT3 gene.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19581295 2009 Heterogeneous nuclear ribonucleoprotein R enhances transcription from the naturally configured c-fos promoter in vitro.
19557575 2009 FOS proliferating network construction in early colorectal cancer (CRC) based on integrative significant function cluster and inferring analysis.
19513521 2009 Expression of Jun and Fos proteins in ovarian tumors of different malignant potential and in ovarian cancer cell lines.
19495976 2010 Involvement of Ras and AP-1 in Helicobacter pylori-induced expression of COX-2 and iNOS in gastric epithelial AGS cells.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19384981 2009 The immediate-early oncoproteins Fra-1, c-Fos, and c-Jun have distinguishable surface behavior and interactions with phospholipids.
19329434 2009 PRIP promotes tumor formation through enhancing serum-responsive factor-mediated FOS expression.
19299513 2009 Trolox prevents osteoclastogenesis by suppressing RANKL expression and signaling.
19269029 2009 Calmodulin interacts with PAC1 and VPAC2 receptors and regulates PACAP-induced FOS expression in human neuroblastoma cells.
19258923 2009 Genetic susceptibility to respiratory syncytial virus bronchiolitis in preterm children is associated with airway remodeling genes and innate immune genes.
19215067 2009 Single nucleotide variants of the TGACTCA motif modulate energetics and orientation of binding of the Jun-Fos heterodimeric transcription factor.
19199093 2009 c-fos gene and protein expression in pelvic endometriosis: a local marker of estrogen action.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
19151755 2009 Downregulation of SRF-FOS-JUNB pathway in fumarate hydratase deficiency and in uterine leiomyomas.
19135542 2009 Pivotal role of c-Fos in nitric oxide synthase 2 expression in airway epithelial cells.
19105933 2008 [Growth factors may enhance c-fos and c-jun gene expressions of hepatic stellate cells].
19028685 2009 Transcriptional synergy mediated by SAF-1 and AP-1: critical role of N-terminal polyalanine and two zinc finger domains of SAF-1.
19022561 2009 The nuclear receptors SF1 and LRH1 are expressed in endometrial cancer cells and regulate steroidogenic gene transcription by cooperating with AP-1 factors.
19015316 2008 Fast regulation of AP-1 activity through interaction of lamin A/C, ERK1/2, and c-Fos at the nuclear envelope.
19009649 2008 c-Fos overexpression increases the proliferation of human hepatocytes by stabilizing nuclear Cyclin D1.
18986987 2008 Tumor-derived variants of Epstein-Barr virus latent membrane protein 1 induce sustained Erk activation and c-Fos.
18957410 2009 Rexinoid-induced expression of IGFBP-6 requires RARbeta-dependent permissive cooperation of retinoid receptors and AP-1.
18923650 2008 Long-range enhancer associated with chromatin looping allows AP-1 regulation of the peptidylarginine deiminase 3 gene in differentiated keratinocyte.
18854825 2008 C-Fos expression is a molecular predictor of progression and survival in epithelial ovarian carcinoma.
18838675 2008 Genome-wide studies highlight indirect links between human replication origins and gene regulation.
18826606 2008 The effects of timing of fine needle aspiration biopsies on gene expression profiles in breast cancers.
18802113 2008 Lipopolysaccharide-induced expression of matrix metalloproteinases in human monocytes is suppressed by IFN-gamma via superinduction of ATF-3 and suppression of AP-1.
18725194 2008 Thermodynamic analysis of the heterodimerization of leucine zippers of Jun and Fos transcription factors.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
18653705 2008 Activator protein-1 and smad proteins synergistically regulate human follicle-stimulating hormone beta-promoter activity.
18644870 2008 Cotranscriptional splicing potentiates the mRNA production from a subset of estradiol-stimulated genes.
18641127 2008 Development of pulmonary fibrosis through a pathway involving the transcription factor Fra-2/AP-1.
18621151 2008 Characterization of the transduction pathway involved in c-fos and c-jun expression induced by Aggregatibacter actinomycetemcomitans lipopolysaccharides in human gingival fibroblasts.
18599327 2009 Behavioral characteristics and c-Fos expression in the medullary dorsal horn in a rat model for orofacial cancer pain.
18597608 2008 Thrombin activates Ras-CREB/ATF-1 signaling and stimulates c-fos, c-jun, and c-myc expression in human gingival fibroblasts.
18500346 2008 Regulation of Tcrb recombination ordering by c-Fos-dependent RAG deposition.
18467434 2008 The G protein-coupled receptor GPR30 inhibits human urothelial cell proliferation.
18425349 2008 Ganoderic acids suppress growth and invasive behavior of breast cancer cells by modulating AP-1 and NF-kappaB signaling.
18422165 2008 [Effects of intranasal budesonide on the expression of c-fos and c-myc in nasal polyps].
18405916 2008 Involvement of connexin 43 in angiotensin II-induced migration and proliferation of saphenous vein smooth muscle cells via the MAPK-AP-1 signaling pathway.
18368600 2008 Bovine dialyzable leukocyte extract modulates AP-1 DNA-binding activity and nuclear transcription factor expression in MCF-7 breast cancer cells.
18316037 2008 Coupling of folding and DNA-binding in the bZIP domains of Jun-Fos heterodimeric transcription factor.
18309110 2008 AP-1-dependent transcriptional regulation of NADPH oxidase in human aortic smooth muscle cells: role of p22phox subunit.
18305042 2008 Kaposi's sarcoma-associated herpesvirus latent gene vFLIP inhibits viral lytic replication through NF-kappaB-mediated suppression of the AP-1 pathway: a novel mechanism of virus control of latency.
18283312 2008 Growth inhibition of non-small cell lung cancer cells by AP-1 blockade using a cJun dominant-negative mutant.
18252863 2008 Angiopoietin-1 promotes endothelial cell proliferation and migration through AP-1-dependent autocrine production of interleukin-8.
18206243 2008 IL-8 production and AP-1 transactivation induced by UVA in human keratinocytes: roles of D-alpha-tocopherol.
18158562 2007 Prognostic significance of loss of c-fos protein in gastric carcinoma.
18032824 2007 EGF-R is expressed and AP-1 and NF-kappaB are activated in stromal myofibroblasts surrounding colon adenocarcinomas paralleling expression of COX-2 and VEGF.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17926144 2008 Identification of c-Fos as a mitotic phosphoprotein: regulation of c-Fos by Aurora-A.
17915561 2007 HSF2 binds to the Hsp90, Hsp27, and c-Fos promoters constitutively and modulates their expression.
17888430 2008 Increased expression of c-fos protein associated with increased matrix metalloproteinase-9 protein expression in the endometrium of endometriotic patients.
17709345 2007 Ubc9 fusion-directed SUMOylation identifies constitutive and inducible SUMOylation.
17703412 2007 Genetic susceptibility to respiratory syncytial virus bronchiolitis is predominantly associated with innate immune genes.
17681951 2007 Heterodimerization with Jun family members regulates c-Fos nucleocytoplasmic traffic.
17639289 2007 Effects of transcription factor activator protein-1 on interleukin-8 expression and enteritis in response to Clostridium difficile toxin A.
17636030 2007 Amino acid residues required for physical and cooperative transcriptional interaction of STAT3 and AP-1 proteins c-Jun and c-Fos.
17606925 2007 Corticothalamic synchronization leads to c-fos expression in the auditory thalamus.
17549045 2007 Pharmacological enhancement of the endocannabinoid system in the nucleus accumbens shell stimulates food intake and increases c-Fos expression in the hypothalamus.
17495958 2007 Biphasic regulation of AP-1 subunits during human epidermal wound healing.
17235455 2007 PTEN down regulates AP-1 and targets c-fos in human glioma cells via PI3-kinase/Akt pathway.
17217916 2007 Reactive oxygen species mediates the apoptosis induced by transforming growth factor beta(2) in human lens epithelial cells.
17209045 2007 Ras/ERK1/2-mediated STAT3 Ser727 phosphorylation by familial medullary thyroid carcinoma-associated RET mutants induces full activation of STAT3 and is required for c-fos promoter activation, cell mitogenicity, and transformation.
17203973 2007 The proteomic reactor facilitates the analysis of affinity-purified proteins by mass spectrometry: application for identifying ubiquitinated proteins in human cells.
17182779 2006 c-Fos facilitates the acquisition and extinction of cocaine-induced persistent changes.
17160021 2007 N-Terminal c-Fos tyrosine phosphorylation regulates c-Fos/ER association and c-Fos-dependent phospholipid synthesis activation.
17080554 2006 Effect of epigallocatechingallate on ultraviolet B-induced photo-damage in keratinocyte cell line.
17018293 2006 Spatiotemporal regulation of c-Fos by ERK5 and the E3 ubiquitin ligase UBR1, and its biological role.
16828227 2006 Acidity induces c-Fos expression in a subpopulation of human colonic submucosal neurons.
16637060 2006 c-Fos is required for TGFbeta1 production and the associated paracrine migratory effects of human colon carcinoma cells.
16552729 2006 Comparative proteomic analysis of apoptosis induced by sodium selenite in human acute promyelocytic leukemia NB4 cells.
16511568 2006 Mutual regulation of c-Jun and ATF2 by transcriptional activation and subcellular localization.
16236267 2005 Proteomic analysis of SUMO4 substrates in HEK293 cells under serum starvation-induced stress.
16219292 2005 INI1/hSNF5/BAF47 represses c-fos transcription via a histone deacetylase-dependent manner.
16123044 2005 Regulation of the transcriptional activity of c-Fos by ERK. A novel role for the prolyl isomerase PIN1.
16055710 2005 Down-regulation of c-Fos/c-Jun AP-1 dimer activity by sumoylation.
16049073 2005 Increased activity of activator protein-1 transcription factor components ATF2, c-Jun, and c-Fos in human and mouse autosomal dominant polycystic kidney disease.
16038047 2005 Effect of c-fos antisense probe on prostaglandin E2-induced upregulation of vascular endothelial growth factor mRNA in human liver cancer cells.
15926923 2005 Forebrain patterns of c-Fos and FosB induction during cancer-associated anorexia-cachexia in rat.
15921770 2005 Vasoactive intestinal peptide (VIP) induces c-fos expression in LNCaP prostate cancer cells through a mechanism that involves Ca2+ signalling. Implications in angiogenesis and neuroendocrine differentiation.
15844599 2005 [The expression of p73 and c-fos protein in hemangioma and its significance].
15835820 2004 [Effects of basic fibroblast growth factor on protein kinase B activity and c-fos expression in CNE- I nasopharyngeal carcinoma cell line].
15767669 2005 TATA-binding protein (TBP)-like factor (TLF) is a functional regulator of transcription: reciprocal regulation of the neurofibromatosis type 1 and c-fos genes by TLF/TRF2 and TBP.
15708845 2005 Phosphorylation of c-Fos by members of the p38 MAPK family. Role in the AP-1 response to UV light.
15654976 2005 Fos and jun proteins are specifically expressed during differentiation of human keratinocytes.
15588513 2004 Enhancement of cell survival by stromal cell-derived factor-1/CXCL12 involves activation of CREB and induction of Mcl-1 and c-Fos in factor-dependent human cell line MO7e.
15548518 2005 Loss of net as repressor leads to constitutive increased c-fos transcription in cervical cancer cells.
15530430 2004 COBRA1 inhibits AP-1 transcriptional activity in transfected cells.
15507668 2004 Constitutive expression of the AP-1 transcription factors c-jun, junD, junB, and c-fos and the marginal zone B-cell transcription factor Notch2 in splenic marginal zone lymphoma.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15276183 2004 MD-2: the Toll 'gatekeeper' in endotoxin signalling.
15262961 2004 Tobacco smoke control of mucin production in lung cells requires oxygen radicals AP-1 and JNK.
15188457 2004 Helicobacter pylori infection activates FOS and stress-response genes and alters expression of genes in gastric cancer-specific loci.
14966901 2004 Expression of Egr-1, c-fos and cyclin D1 in esophageal cancer and its precursors: An immunohistochemical and in situ hybridization study.
14741347 2004 Placental growth factor induces FosB and c-Fos gene expression via Flt-1 receptors.
14727154 2004 LRP5, low-density-lipoprotein-receptor-related protein 5, is a determinant for bone mineral density.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14629301 2003 Identification of neurons responding to hypoxia in sudden infant death syndrome.
14522952 2003 STAT3-dependent enhanceosome assembly and disassembly: synergy with GR for full transcriptional increase of the alpha 2-macroglobulin gene.
14517309 2003 c-Fos proto-oncoprotein is degraded by the proteasome independently of its own ubiquitinylation in vivo.
14511403 The role of JNK and p38 MAPK activities in UVA-induced signaling pathways leading to AP-1 activation and c-Fos expression.
12972619 2003 Phosphorylation of the carboxyl-terminal transactivation domain of c-Fos by extracellular signal-regulated kinase mediates the transcriptional activation of AP-1 and cellular transformation induced by platelet-derived growth factor.
12949493 2003 Structure of NFAT1 bound as a dimer to the HIV-1 LTR kappa B element.
12788789 2003 STAT-1 and c-Fos interaction in nitric oxide synthase-2 gene activation.
12705898 2003 p21waf1/cip1 is down-regulated in conjunction with up-regulation of c-Fos in the lymphocytes of rheumatoid arthritis patients.
12692226 2003 Members of the AP-1 family, c-Jun and c-Fos, functionally interact with JC virus early regulatory protein large T antigen.
12687275 2003 P53 and C-FOS overexpression in patients with thyroid cancer: an immunohistochemical study.
12600988 2003 Independent and cooperative activation of chromosomal c-fos promoter by STAT3.
12592382 2003 ERK signaling pathway is involved in p15INK4b/p16INK4a expression and HepG2 growth inhibition triggered by TPA and Saikosaponin a.
12547826 2003 Tumor promoter arsenite stimulates histone H3 phosphoacetylation of proto-oncogenes c-fos and c-jun chromatin in human diploid fibroblasts.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12446585 2002 Estrogen receptor alpha and activating protein-1 mediate estrogen responsiveness of the progesterone receptor gene in MCF-7 breast cancer cells.
12445807 2002 Transcriptional activation of the c-fos gene by a LIM protein, Hic-5.
12193410 2002 An activator protein-1 complex mediates epidermal growth factor regulation of equine glycoprotein alpha subunit expression in trophoblast cells.
12183893 [Possible role of transcription factor AP1 in the tissue-specific regulation of human papillomavirus].
12147741 2002 Gene expression profiling of ameloblastoma and human tooth germ by means of a cDNA microarray.
12134156 2002 Molecular interpretation of ERK signal duration by immediate early gene products.
12127989 2002 c-Fos is a surface pressure-dependent diverter of phospholipase activity.
12082260 2002 Effects of fluid shear stress on expression of proto-oncogenes c-fos and c-myc in cultured human umbilical vein endothelial cells.
12052862 2002 Retinoic acid receptors inhibit AP1 activation by regulating extracellular signal-regulated kinase and CBP recruitment to an AP1-responsive promoter.
11983170 2002 Visualization of interactions among bZIP and Rel family proteins in living cells using bimolecular fluorescence complementation.
11909859 2002 Analysis of heterophilic and homophilic interactions of cadherins using the c-Jun/c-Fos dimerization domains.
11891317 2002 Bombesin antagonists inhibit growth of MDA-MB-435 estrogen-independent breast cancers and decrease the expression of the ErbB-2/HER-2 oncoprotein and c-jun and c-fos oncogenes.
11846562 2001 Crystal structure of a ternary SAP-1/SRF/c-fos SRE DNA complex.
11641401 2002 Physical interaction of the activator protein-1 factors c-Fos and c-Jun with Cbfa1 for collagenase-3 promoter activation.
11397816 2001 Involvement of Hgs/Hrs in signaling for cytokine-mediated c-fos induction through interaction with TAK1 and Pak1.
11397794 2001 Inhibition of AP-1 by the glucocorticoid-inducible protein GILZ.
11278640 2001 Identification of amino acid residues in the ETS transcription factor Erg that mediate Erg-Jun/Fos-DNA ternary complex formation.
11260070 2001 Extracellular Tat activates c-fos promoter in low serum-starved CD4+ T cells.
11134330 2001 Interleukin-6-induced STAT3 and AP-1 amplify hepatocyte nuclear factor 1-mediated transactivation of hepatic genes, an adaptive response to liver injury.
11053448 2001 Identification of SWI.SNF complex subunit BAF60a as a determinant of the transactivation potential of Fos/Jun dimers.
10918580 2000 Differential transcriptional regulation of the monocyte-chemoattractant protein-1 (MCP-1) gene in tumorigenic and non-tumorigenic HPV 18 positive cells: the role of the chromatin structure and AP-1 composition.
10799874 2000 Differential requirement for p56lck in HIV-tat versus TNF-induced cellular responses: effects on NF-kappa B, activator protein-1, c-Jun N-terminal kinase, and apoptosis.
10777532 2000 Silencing mediator of retinoic acid and thyroid hormone receptors, as a novel transcriptional corepressor molecule of activating protein-1, nuclear factor-kappaB, and serum response factor.
10764760 2000 Transactivation of naturally occurring HIV-1 long terminal repeats by the JNK signaling pathway. The most frequent naturally occurring length polymorphism sequence introduces a novel binding site for AP-1 factors.
10567391 1999 The role of human MBF1 as a transcriptional coactivator.
10523647 1999 CHOP enhancement of gene transcription by interactions with Jun/Fos AP-1 complex proteins.
10497212 1999 Bcl3, an IkappaB protein, stimulates activating protein-1 transactivation and cellular proliferation.
10488148 1999 ERK MAP kinase links cytokine signals to activation of latent HIV-1 infection by stimulating a cooperative interaction of AP-1 and NF-kappaB.
9918847 1999 Microphthalmia-associated transcription factor interacts with PU.1 and c-Fos: determination of their subcellular localization.
9888853 1999 Role of DNA 5-methylcytosine transferase in cell transformation by fos.
9792677 1998 RSK-B, a novel ribosomal S6 kinase family member, is a CREB kinase under dominant control of p38alpha mitogen-activated protein kinase (p38alphaMAPK).
9732876 1998 Smad3 and Smad4 cooperate with c-Jun/c-Fos to mediate TGF-beta-induced transcription.
9685505 1998 Casein kinase II interacts with the bZIP domains of several transcription factors.
9681824 1998 Erg proteins, transcription factors of the Ets family, form homo, heterodimers and ternary complexes via two distinct domains.
9671405 1998 Modulation of Fos-mediated AP-1 transcription by the promyelocytic leukemia protein.
9642216 1998 Steroid receptor coactivator-1 coactivates activating protein-1-mediated transactivations through interaction with the c-Jun and c-Fos subunits.
9510247 1998 Structure of the DNA-binding domains from NFAT, Fos and Jun bound specifically to DNA.
9468519 1998 Role of activating protein-1 in the regulation of the vascular cell adhesion molecule-1 gene expression by tumor necrosis factor-alpha.
9443941 1998 Platelet-activating factor induction of activator protein-1 signaling in bronchial epithelial cells.
9346889 1997 A regulatory element within a coding exon modulates keratin 18 gene expression in transgenic mice.
9334186 1997 The Ets transcription factors interact with each other and with the c-Fos/c-Jun complex via distinct protein domains in a DNA-dependent and -independent manner.
9207128 1997 Angiotensin II type1a receptor gene expression in the heart: AP-1 and GATA-4 participate in the response to pressure overload.
9129988 1997 An RGD containing peptide from HIV-1 Tat-(65-80) modulates protooncogene expression in human bronchoalveolar carcinoma cell line, A549.
9121455 1997 Control of NFATx1 nuclear translocation by a calcineurin-regulated inhibitory domain.
9057648 1997 Upregulation of c-Fos in activated T lymphoid and monocytic cells by human immunodeficiency virus-1 Tat protein.
8971979 1996 Activation of c-fos in the brain.
8904195 1995 c-Fos expression during wakefulness and sleep.
8763994 1996 AP1 enhances polyomavirus DNA replication by promoting T-antigen-mediated unwinding of DNA.
8737385 1996 C-fos and c-jun expression in human endometrium and myometrium.
8710853 1996 Mammalian Sug1 and c-Fos in the nuclear 26S proteasome.
8628277 1996 Fos-Jun dimerization promotes interaction of the basic region with TFIIE-34 and TFIIF.
8617242 1996 The human papillomavirus type 16 E7 gene product interacts with and trans-activates the AP1 family of transcription factors.
8570175 1995 B-ATF: a novel human bZIP protein that associates with members of the AP-1 transcription factor family.
8557686 1996 Synergistic transcriptional activation of the tissue inhibitor of metalloproteinases-1 promoter via functional interaction of AP-1 and Ets-1 transcription factors.
8475068 1993 Sp-1 binds promoter elements regulated by the RB protein and Sp-1-mediated transcription is stimulated by RB coexpression.
8397339 1993 The T-cell transcription factor NFATp is a substrate for calcineurin and interacts with Fos and Jun.
8248197 1993 Phosphorylation of the c-Fos transrepression domain by mitogen-activated protein kinase and 90-kDa ribosomal S6 kinase.
8108109 1994 Maf and Nrl can bind to AP-1 sites and form heterodimers with Fos and Jun.
8065335 1994 c-Fos-induced activation of a TATA-box-containing promoter involves direct contact with TATA-box-binding protein.
7994752 1994 Anti-IgM and anti-IgG modulate c-fos RNA levels differently in human B lymphocytes.
7962462 1994 Regulation of gene expression in T-47D human breast cancer cells by progestins and antiprogestins.
7816602 1994 Phosphorylation of the c-Fos and c-Jun HOB1 motif stimulates its activation capacity.
7816143 1995 Crystal structure of the heterodimeric bZIP transcription factor c-Fos-c-Jun bound to DNA.
7713192 1994 Effects of dexamethasone on cytokine and phorbol ester stimulated c-Fos and c-Jun DNA binding and gene expression in human lung.
7685215 1993 The bZIP domains of Fos and Jun mediate a physical association with the TATA box-binding protein.
7665092 1995 Cloning of the cDNA encoding human C/EBP gamma, a protein binding to the PRE-I enhancer element of the human interleukin-4 promoter.
7588633 1995 The Mos/MAP kinase pathway stabilizes c-Fos by phosphorylation and augments its transforming activity in NIH 3T3 cells.
7540136 1995 Comparative analysis of the ternary complex factors Elk-1, SAP-1a and SAP-2 (ERP/NET).
6574479 1983 Complete nucleotide sequence of a human c-onc gene: deduced amino acid sequence of the human c-fos protein.
3817017 1987 Human c-fos proto-oncogene mapped to chromosome 14, band q24.3-q31. Possibilities for oncogene activation by chromosomal rearrangements in human neoplasms.
3555978 1986 Human fos gene.
3027573 1987 Deregulated c-fos expression interferes with normal bone development in transgenic mice.
2516827 1989 Transcription factor ATF cDNA clones: an extensive family of leucine zipper proteins able to selectively form DNA-binding heterodimers.
2511004 1989 The basic region of Fos mediates specific DNA binding.
2414012 1985 Transient accumulation of c-fos RNA following serum stimulation requires a conserved 5' element and c-fos 3' sequences.
1903538 1991 Human X-box-binding protein 1 is required for the transcription of a subset of human class II major histocompatibility genes and forms a heterodimer with c-fos.
1828107 1991 Identification of multiple nuclear factors that interact with cyclic adenosine 3',5'-monophosphate response element-binding protein and activating transcription factor-2 by protein-protein interactions.
1658710 1991 Retrovirus-mediated gene transfer of a human c-fos cDNA into mouse bone marrow stromal cells.
1631061 1992 Protein interaction cloning in yeast: identification of mammalian proteins that react with the leucine zipper of Jun.
1589769 1992 Interaction cloning: identification of a helix-loop-helix zipper protein that interacts with c-Fos.
1545828 1992 Alteration of a cyclic AMP-dependent protein kinase phosphorylation site in the c-Fos protein augments its transforming potential.
1406655 1992 Interactions among LRF-1, JunB, c-Jun, and c-Fos define a regulatory program in the G1 phase of liver regeneration.