Property Summary

NCBI Gene PubMed Count 307
PubMed Score 13094.72
PubTator Score 3823.55

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (5)

Disease Target Count P-value
periodontitis 269 2.20624960549882E-12
psoriasis 6685 4.44405654373043E-12
chronic lymphosyte leukemia 232 6.58501654276318E-12
inflammatory breast cancer 404 3.36989156402169E-11
lung carcinoma 2844 3.17646939932978E-9
lung cancer 4473 3.22505373641213E-7
lung adenocarcinoma 2714 1.57562677508724E-6
malignant mesothelioma 3163 1.81918961768856E-6
pituitary cancer 1972 2.1778152731679E-5
breast carcinoma 1614 1.19532587143376E-4
gastric cancer 436 2.20273758553481E-4
Rheumatoid Arthritis 1171 5.39465494248345E-4
ulcerative colitis 2087 9.30476973276876E-4
nephrosclerosis 329 9.33963676937904E-4
glioblastoma 5572 0.00120254271570234
ovarian cancer 8492 0.00209035249551277
astrocytoma 1493 0.00211995845465445
urothelial carcinoma 318 0.00222685511729869
fascioscapulohumeral muscular dystrophy 100 0.00543056967404766
group 4 medulloblastoma 1875 0.00597279697983607
adrenocortical carcinoma 1427 0.00644733091553244
posterior fossa group A ependymoma 1511 0.00999090625014429
fibroadenoma 557 0.0102565173339275
aldosterone-producing adenoma 664 0.0149740545640541
colon cancer 1475 0.0201231563147511
non-small cell lung cancer 2798 0.0218350331879438
pterygium 74 0.0272716643415499
non primary Sjogren syndrome sicca 840 0.0292198214178449
limb girdle muscular dystrophy 2I 56 0.0305387431612051
acute myeloid leukemia 785 0.0308682363821704
Down syndrome 548 0.0344001436081975
Waldenstrons macroglobulinemia 765 0.0494501887260332
Disease Target Count Z-score Confidence
Cancer 2346 5.833 2.9

Expression

  Differential Expression (33)

Disease log2 FC p
Rheumatoid Arthritis 1.800 0.001
nephrosclerosis -2.599 0.001
gastric cancer -1.700 0.000
hepatocellular carcinoma -1.200 0.006
Waldenstrons macroglobulinemia 1.126 0.049
urothelial carcinoma -2.900 0.002
malignant mesothelioma 1.200 0.000
chronic lymphosyte leukemia -3.300 0.000
group 4 medulloblastoma -2.400 0.006
astrocytoma 3.300 0.002
glioblastoma 3.300 0.001
periodontitis 1.200 0.000
limb girdle muscular dystrophy 2I 1.974 0.031
fascioscapulohumeral muscular dystrophy 1.962 0.005
adrenocortical carcinoma -2.000 0.006
non-small cell lung cancer -2.300 0.022
lung cancer -3.900 0.000
colon cancer -2.500 0.020
breast carcinoma -2.100 0.000
fibroadenoma -2.700 0.010
lung adenocarcinoma -1.300 0.000
posterior fossa group A ependymoma 1.300 0.010
non primary Sjogren syndrome sicca -1.400 0.029
aldosterone-producing adenoma -2.293 0.015
psoriasis -3.400 0.000
inflammatory breast cancer -5.700 0.000
lung carcinoma -2.400 0.000
pterygium -3.500 0.027
acute myeloid leukemia 1.400 0.031
ulcerative colitis 2.600 0.001
ovarian cancer 2.300 0.002
pituitary cancer -3.800 0.000
Down syndrome 1.300 0.034

Synonym

Accession P01100 A8K4E2 B4DQ65 P18849
Symbols p55
AP-1
C-FOS

Gene

FOS

PANTHER Protein Class (1)

PDB

1A02   1S9K   1FOS  

  Ortholog (13)

Gene RIF (241)

PMID Text
26988982 These results indicate that IL-17A enhances COX2 expression and PGE2 production via the p38/c-Fos and JNK/c-Jun signalling pathways in NP cells to mediate intervertebral disc inflammation.
26858249 Simultaneous high expression of ID1 and c-Jun or c-Fos was correlated with poor survival in esophageal squamous cell carcinoma patients.
26631725 A novel AP-1 binding site at -1363 bp of the human TF promoter region was identified.
26493679 Increased c-Fos expression is through TRPM3-mediated stimulation of the c-Fos promoter.
26381409 The RNA binding complexes NF45-NF90 and NF45-NF110 associate dynamically with the c-fos gene and function as transcriptional coactivators.
26303532 These results establish c-Fos homodimers as a novel form of the AP-1 complex that may be an autonomous transcription factor in c-Fos-overexpressing tissues and could contribute to tumor development.
26209639 Data show that interleukin-1 receptor type 2 (IL1R2) forms a complex with c-Fos proto-oncogene protein and activates the interleukin-6 (IL-6) and vascular endothelial growth factor A (VEGF-A) promoters.
26173738 The translocation causes truncation of the FOS protein, with loss of the transactivation domain, which is thereby a novel mechanism involved in tumorigenesis.
26112171 miR-146a has a role in targeting Fos expression in human cardiac cells
26018080 co-expression of c-Fos or Fra1 was able to cooperate with TAp73 in potentiating cellular growth, similarly to c-Jun. These data together suggest that TAp73 plays a vital role in activation of AP-1 target genes via direct binding to c-Jun
More...

AA Sequence

MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDFCTDLAVSSANFIPTVTAISTS      1 - 70
PDLQWLVQPALVSSVAPSQTRAPHPFGVPAPSAGAYSRAGVVKTMTGGRAQSIGRRGKVEQLSPEEEEKR     71 - 140
RIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQTEIANLLKEKEKLEFILAAHRPACKIPDDL    141 - 210
GFPEEMSVASLDLTGGLPEVATPESEEAFTLPLLNDPEPKPSVEPVKSISSMELKTEPFDDFLFPASSRP    211 - 280
SGSETARSVPDMDLSGSFYAADWEPLHSGSLGMGPMATELEPLCTPVVTCTPSCTAYTSSFVFTYPEADS    281 - 350
FPSCAAAHRKGSSSNEPSSDSLSSPTLLAL                                            351 - 380
//

Text Mined References (313)

PMID Year Title
26988982 2016 IL-17 mediates inflammatory reactions via p38/c-Fos and JNK/c-Jun activation in an AP-1-dependent manner in human nucleus pulposus cells.
26858249 2016 Inhibitor of Differentiation/DNA Binding 1 (ID1) Inhibits Etoposide-induced Apoptosis in a c-Jun/c-Fos-dependent Manner.
26631725 2016 Purinergic P2Y2 Receptor Control of Tissue Factor Transcription in Human Coronary Artery Endothelial Cells: NEW AP-1 TRANSCRIPTION FACTOR SITE AND NEGATIVE REGULATOR.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26493679 2016 CREB, AP-1, ternary complex factors and MAP kinases connect transient receptor potential melastatin-3 (TRPM3) channel stimulation with increased c-Fos expression.
26381409 2015 The RNA binding complexes NF45-NF90 and NF45-NF110 associate dynamically with the c-fos gene and function as transcriptional coactivators.
26303532 2015 Evidence for Homodimerization of the c-Fos Transcription Factor in Live Cells Revealed by Fluorescence Microscopy and Computer Modeling.
26209639 2015 Interleukin-1 Receptor Type 2 Acts with c-Fos to Enhance the Expression of Interleukin-6 and Vascular Endothelial Growth Factor A in Colon Cancer Cells and Induce Angiogenesis.
26173738 2015 Fusion events lead to truncation of FOS in epithelioid hemangioma of bone.
26112171 2015 miR-146a targets Fos expression in human cardiac cells.
More...