Property Summary

Ligand Count 28
NCBI Gene PubMed Count 118
PubMed Score 206.10
PubTator Score 194.63

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Neurodegenerative disease 414 0.0 4.0

Expression

  Differential Expression (22)

Disease log2 FC p
adult high grade glioma 1.800 1.1e-04
atypical teratoid / rhabdoid tumor 1.300 1.4e-03
Breast cancer -3.500 8.6e-14
breast carcinoma -1.400 4.9e-02
cutaneous lupus erythematosus -1.200 3.3e-02
diabetes mellitus 1.100 1.2e-03
Endometriosis -1.371 3.0e-02
ependymoma 3.200 1.3e-11
glioblastoma 1.300 3.8e-03
intraductal papillary-mucinous adenoma (... -3.400 1.1e-03
intraductal papillary-mucinous carcinoma... -3.100 9.3e-03
intraductal papillary-mucinous neoplasm ... -3.300 1.5e-02
invasive ductal carcinoma -1.199 1.0e-02
lung adenocarcinoma -1.400 1.0e-05
lung cancer -1.600 7.2e-04
lung carcinoma -1.200 3.0e-11
malignant mesothelioma 3.500 3.3e-08
medulloblastoma, large-cell 1.200 1.3e-03
non-small cell lung cancer -3.701 1.4e-16
ovarian cancer 4.600 3.0e-08
pituitary cancer 2.900 5.0e-03
psoriasis -1.900 5.6e-04

Gene RIF (91)

AA Sequence

MAQRMTTQLLLLLVWVAVVGEAQTRIAWARTELLNVCMNAKHHKEKPGPEDKLHEQCRPWRKNACCSTNT      1 - 70
SQEAHKDVSYLYRFNWNHCGEMAPACKRHFIQDTCLYECSPNLGPWIQQVDQSWRKERVLNVPLCKEDCE     71 - 140
QWWEDCRTSYTCKSNWHKGWNWTSGFNKCAVGAACQPFHFYFPTPTVLCNEIWTHSYKVSNYSRGSGRCI    141 - 210
QMWFDPAQGNPNEEVARFYAAAMSGAGPWAAWPFLLSLALMLLWLLS                           211 - 257
//

Text Mined References (122)

PMID Year Title