Property Summary

NCBI Gene PubMed Count 112
PubMed Score 181.40
PubTator Score 194.63

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Neurodegenerative disease 383 0.0 4.0

Expression

  Differential Expression (22)

Disease log2 FC p
malignant mesothelioma 3.500 3.3e-08
cutaneous lupus erythematosus -1.200 3.3e-02
psoriasis -1.900 5.6e-04
posterior fossa group B ependymoma 4.200 3.9e-17
atypical teratoid / rhabdoid tumor 1.300 1.4e-03
glioblastoma 1.300 3.8e-03
medulloblastoma, large-cell 1.200 1.3e-03
non-small cell lung cancer -3.701 1.4e-16
intraductal papillary-mucinous adenoma (... -3.400 1.1e-03
intraductal papillary-mucinous carcinoma... -3.100 9.3e-03
intraductal papillary-mucinous neoplasm ... -3.300 1.5e-02
lung cancer -2.900 1.4e-05
breast carcinoma -1.400 4.9e-02
diabetes mellitus 1.100 1.2e-03
lung adenocarcinoma -1.700 6.1e-03
adult high grade glioma 1.800 1.1e-04
invasive ductal carcinoma -1.199 1.0e-02
Endometriosis -1.371 3.0e-02
non-inflammatory breast cancer -4.300 1.1e-04
lung carcinoma -1.200 3.0e-11
ovarian cancer 4.600 3.0e-08
pituitary cancer 2.900 5.0e-03

Gene RIF (85)

PMID Text
26617855 Suppression of FOLR1 by RNA interference altered gene expression profile of taxol-resistant nasopharyngeal carcinoma cells. Apoptosis-related genes, gene alterations in viral carcinogenesis/MAPK pathways may be important for taxol resistance reversal.
26606305 This new protocol opens an effective way through synthesis and design of novel fluorescent nano-conjugates for FR expression investigation in tumor cells via targeted imaging, showing great potential in drug delivery mechanism study and cancer therapy
26359629 Suggest RNA CAR T cell therapy for the treatment of common epithelial cancers expressing folate receptor-alpha.
26191275 Suggest that FRalpha overexpression may play a role in the endometrioid endometrium carcinoma carcinogenesis and carcinoma progression from endometrial hyperplasia.
26149693 Folate receptor expression on murine and human adipose tissue macrophages
26014017 The overexpression of folate receptor alpha mRNA was associated with growth of pituitary adenomas.
25971554 we confirmed the similarities between epithelial ovarian cancer and fallopian tube, normal and adenocarcinoma using FOLR1, FOLR2, CD68 and CD11b markers
25904506 Findings suggest the clinical development of IMGN853 as a novel targeted therapy for patients with folate receptor alpha (FRalpha)-expressing tumors.
25816016 triple negative/basal tumors were significantly associated with increased expression of FOLR1 mRNA, compared to ER+ and HER2+ tumors.
25697897 this is the first study to simultaneously evaluate both DNA methylation and protein expression of all three folate transporter genes, FOLR1, PCFT, and RFC1, in colorectal cancer.
25564455 Studies indicate folate receptor (FR) as a prognostic biomarker for ovarian cancer.
25323390 Molecular dynamic simulation of the binding process of folic acid to folate receptor alpha
25081683 FRalpha down-regulation might be capable of suppressing cervical cancer cell proliferation and promoting apoptosis.
24993594 Survival times are improved in non-small-cell lung cancer patients whose tumors show strong membranous folate receptor alpha expression.
24810481 the conditions associated with circulating FOLR1 protein in healthy individuals
24771263 We concluded that quantitation of CTCs through FRalpha ligand-PCR could be a promising method for noninvasive diagnosis of bladder TCC.
24206618 The FRalpha gene was expressed in all parathyroid cells analyzed, and the FRbeta gene was expressed by most.
24028341 74% of ER/PR-negative and 80% of triple-negative breast cancers expressed folate receptor alpha (FRA). The expression of FRA was significantly associated with a worse disease-free survival.
23851396 crystal structure of human FRalpha in complex with folic acid at 2.8 A resolution
23528302 FOLR1 was significantly elevated in the serum of ovarian cancer patients compared to serum of both healthy controls and patients with benign gynecological conditions.
23518909 The data presented further support the hypothesis that folate receptor-alpha expression in gynecologic tumors is due to the cell of origin normally expressing this receptor
23357463 Studies indicate that folate receptor alpha (FOLR1), a folate transporter, is an attractive target for cancer therapy due to its high affinity for folate, restricted range of expression in normal tissue and differential over-expression in malignant tissue.
23332132 EpCAM, FR-alpha, and VEGF-A are the most promising molecules for use in targeted intraoperative fluorescence imaging of endometriotic lesions owing to their favorable expression patterns and biomarker characteristics
23243496 The folate receptor alpha translocates to the nucleus, where it binds to cis-regulatory elements at promoter regions of Fgfr4 and Hes1, and regulates their expression.
23144806 Overexpression of folate receptor alpha was associated with ovarian tumor progression.
23023342 Expression of FOLR1 is higher in pituitary adenomas of patients who are older than 50 years.
22984810 a large percentage of lung cancers, including squamous cell carcinomas in addition to adenocarcinomas, strongly express folate receptor alpha
22729036 High folate receptor alpha is associated with adenocarcinoma in non-small-cell lung carcinoma and and EGFR [corrected] mutation.
22586289 studies suggest that different clinical severities do not necessarily correlate with residual function of folate receptor alpha mutants.
22304562 PCR analysis had confirmed the existence of FR-alpha, SMVT, and B ((0, +)) in Y-79 and ARPE-19 cells.
22265591 alpha-FR can be a potential biomarker for the prediction of chemotherapeutic responses and clinical prognosis.
22089756 FRalpha may play an important role in the development and progression of NFAs.
21938430 An ancient double-mutated haplotype 1816delC-1841A in the FOLR1 gene, is demonstrated.
21647742 FR-alpha was expressed in the majority of serous ovarian tumors, although >50% of cases showed only weak expression.
21572402 FRalpha expression is present in a subset of resected hepatic colorectal cancer metastases, and this marker is independently associated with survival
21215723 Data show that the photocytotoxicity induced by folate-targeted liposomes was improved.
21215165 FRalpha mRNA levels were significantly higher in ovarian carcinomas compared with that of the borderline tumors.
21215055 The expression of FOLR1 is closely related to the occurrence of nasopharyngeal carcinoma and Taxol resistance.
20857335 Mutation screening in the FOLR1 gene is advisable in children with profound 5MTHF deficiency and decreased CSF/serum folate ratio.
20817090 Since the placenta is rich in C/EBPalpha, the findings underscore the multiplicity of mechanisms by which the FRalpha gene is under the exquisite control of steroid hormones.
20683905 The rare alleles of specific single nucleotide polymorphisms within the FOLR1, FOLR2, and FOLR3 genes were statistically significant for association with meningomyelocele.
20683905 Observational study of gene-disease association. (HuGE Navigator)
20634891 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20424473 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20037791 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20036773 Using immunohistochemistry, FRalpha was localized to microvillous plasma membrane of syncytiotrophoblasts during first trimester and at term.
19952865 High maternal autoantibody levels and blocking of folate binding to FRalpha in maternal serum during pregnancy are not associated with an increased risk of oral clefts in the offspring in this population-based cohort.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19732866 An inherited brain-specific folate transport defect that is caused by mutations in the folate receptor 1 (FOLR1) gene coding for folate receptor alpha, was identified.
19617914 results demonstrate that ovarian cancer patients have elevated levels of functional intact FRalpha. These findings support the potential use of circulating FRalpha as a biomarker of early ovarian cancer
19585555 There were no clear individual associations between methionine, vitamin B(6), or multivitamin use and ovarian cancer risk overall or by FRalpha tumor status.
19493349 Observational study of gene-disease association. (HuGE Navigator)
19493312 Results identify the presence of folate receptor alpha in normal and pathological melanocytes and demonstrated that methotrexate is preferentially transported through this receptor in melanoma cells.
19454358 folate receptor levels effectively differentiate ovarian carcinoma from other cancers affecting the serosal cavities
19446551 FRalpha regulates pituitary tumor cell proliferation and mechanistically may involve the NOTCH pathway
19336370 Observational study of gene-disease association. (HuGE Navigator)
19324355 Observational study of gene-disease association. (HuGE Navigator)
19161160 Observational study of gene-disease association. (HuGE Navigator)
19159907 To determine the influence of the genotype involved in RFC1 on the response to methotrexate treatment in pediatric osteosarcomas. Altered expression of RFC1 is a feasible mechanism by which osteosarcoma cells become resistant to methotrexate.
19093297 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19074442 that PCFT plays a role in FRalpha-mediated endocytosis by serving as a route of export of folates from acidified endosomes
19048631 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18988749 Observational study of genetic testing. (HuGE Navigator)
18588513 FBP/FRalpha isoforms were demonstrated for the 1st time in human blood.These isoforms on erythrocyte membranes, in granulocytes & serum, only constituted an almost undetectable fraction of the functional FBP. The FBPalpha in neutrophils was cytoplasmic.
18181001 Higher levels of FOLR1 appear to be associated with better prognoses for patients with lung adenocarcinomas.
17912458 Observational study of gene-disease association. (HuGE Navigator)
17912458 Eight novel rare FOLR1 mutations with a combined prevalence of approximately 1.3% in Whites as well as two common polymorphisms with 5% and 13%, respectively, have been demonstrated.
17554378 folate receptor type beta is induced in a bone marrow engraftment model of acute myelogenous leukemia
17487842 intensity of folate receptor staining was strongly correlated with breast cancer outcome
17473184 This study suggests that FR alpha plays a role in the uptake of 5-methyltetrahydrofolate when the concentration gradient is insufficient for reduced folate carrier -mediated transport.
17035141 Observational study of gene-disease association. (HuGE Navigator)
16475900 Novel mutations in the 5'-UTR of the FOLR1 gene were discovered in patients with elevated levels of homocysteine.
16453285 FRalpha might confer a growth advantage to the tumor by modulating folate uptake from serum or by generating regulatory signals.
16128986 FBP secreted from epithelia of epididymis & vas deferens. A small fraction of FBP associated with prostasome-like vesicles which adhere to spermatozoa in epididymal duct. FBP may have bacteriostatic function depriving folate-requiring bacteria of folate.
15754024 Observational study of gene-disease association. (HuGE Navigator)
15754024 polymorphism may contribute to susceptibility to gastric cancer in at-risk Chinese
15340044 Downrwegulated in an antifolate resistant leukemia cell line.
14972645 Observational study of genotype prevalence. (HuGE Navigator)
14972645 Mutations in the 5'-untranslated region and proximal promoter of the folate receptor-alpha (FR-alpha) gene could be a new factor contributing to gene-food interaction explaining part of the hyperhomocysteinemia panorama.
12839949 The possible anticancer agent, CB300838 has a low affinity for this carrier which makes it a possible antitumor agent.
12612090 Nuclear mRNA instability due to a new ORF element determines tissue specificity of FRalpha. FR-alpha has constitutive mRNA & protein synthesis during the cell cycle & slow protein turnover, ensuring a high steady-state level to override the instability.
12516786 The 27 kDa protein representing soluble folate binding protein exhibited a greater affinity for ligand binding than the 100 kDa protein which possesses a hydrophobic tail identical to the one that anchors the folate receptor to the cell membrane.
11925593 findings suggest that up-regulation of FRalpha gene and calcyclin gene expressions induced by Allitridi may play an important role in human gastric cancer cell differentiation

AA Sequence

MAQRMTTQLLLLLVWVAVVGEAQTRIAWARTELLNVCMNAKHHKEKPGPEDKLHEQCRPWRKNACCSTNT      1 - 70
SQEAHKDVSYLYRFNWNHCGEMAPACKRHFIQDTCLYECSPNLGPWIQQVDQSWRKERVLNVPLCKEDCE     71 - 140
QWWEDCRTSYTCKSNWHKGWNWTSGFNKCAVGAACQPFHFYFPTPTVLCNEIWTHSYKVSNYSRGSGRCI    141 - 210
QMWFDPAQGNPNEEVARFYAAAMSGAGPWAAWPFLLSLALMLLWLLS                           211 - 257
//

Text Mined References (116)

PMID Year Title
26617855 2015 Gene expression profiling of taxol-resistant nasopharyngeal carcinoma cells with siRNA-mediated FOLR1 downregulation.
26606305 2016 Folic acid-conjugated fluorescent polymer for up-regulation folate receptor expression study via targeted imaging of tumor cells.
26359629 2015 Rigorous optimization and validation of potent RNA CAR T cell therapy for the treatment of common epithelial cancers expressing folate receptor.
26191275 2015 Folate receptor ? expression and significance in endometrioid endometrium carcinoma and endometrial hyperplasia.
26149693 2015 Folate receptor expression on murine and human adipose tissue macrophages.
26014017 2015 Increase in folate receptor alpha expression in nonfunctional pituitary adenomas.
25971554 2015 Expression of folate receptors alpha and beta in normal and cancerous gynecologic tissues: correlation of expression of the beta isoform with macrophage markers.
25904506 2015 IMGN853, a Folate Receptor-? (FR?)-Targeting Antibody-Drug Conjugate, Exhibits Potent Targeted Antitumor Activity against FR?-Expressing Tumors.
25816016 2015 Folate receptor-? (FOLR1) expression and function in triple negative tumors.
25697897 2015 DNA methylation and expression of the folate transporter genes in colorectal cancer.
25564455 2015 Role of the folate receptor in ovarian cancer treatment: evidence, mechanism, and clinical implications.
25323390 2015 Intermediate states in the binding process of folic acid to folate receptor ?: insights by molecular dynamics and metadynamics.
25081683 2014 Down-regulation of FR? inhibits proliferation and promotes apoptosis of cervical cancer cells in vitro.
24993594 2014 Assessment of folate receptor-? and epidermal growth factor receptor expression in pemetrexed-treated non-small-cell lung cancer patients.
24810481 2014 Conditions associated with circulating tumor-associated folate receptor 1 protein in healthy men and women.
24771263 2014 Quantitation of rare circulating tumor cells by folate receptor ? ligand-targeted PCR in bladder transitional cell carcinoma and its potential diagnostic significance.
24206618 2013 Expression of functional folate receptors by human parathyroid cells.
24028341 2014 Folate receptor ? associated with triple-negative breast cancer and poor prognosis.
23934049 2013 Structures of human folate receptors reveal biological trafficking states and diversity in folate and antifolate recognition.
23851396 2013 Structural basis for molecular recognition of folic acid by folate receptors.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23528302 2013 Folate-receptor 1 (FOLR1) protein is elevated in the serum of ovarian cancer patients.
23518909 2013 Expression of folate receptor-? (FRA) in gynecologic malignancies and its relationship to the tumor type.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23357463 2013 Farletuzumab in lung cancer.
23332132 2013 Analysis of biomarker expression in severe endometriosis and determination of possibilities for targeted intraoperative imaging.
23243496 2012 Nuclear localization of folate receptor alpha: a new role as a transcription factor.
23144806 2012 Paradoxical impact of two folate receptors, FR? and RFC, in ovarian cancer: effect on cell proliferation, invasion and clinical outcome.
23023342 2012 Expression of genes FOLR1, BAG1 and LAPTM4B in functioning and non-functioning pituitary adenomas.
22984810 2013 Folate receptor in adenocarcinoma and squamous cell carcinoma of the lung: potential target for folate-linked therapeutic agents.
22729036 2012 High expression of folate receptor alpha in lung cancer correlates with adenocarcinoma histology and EGFR [corrected] mutation.
22586289 2012 Molecular characterization of folate receptor 1 mutations delineates cerebral folate transport deficiency.
22304562 2012 Differential expression of folate receptor-alpha, sodium-dependent multivitamin transporter, and amino acid transporter (B (0, +)) in human retinoblastoma (Y-79) and retinal pigment epithelial (ARPE-19) cell lines.
22265591 2012 Serous ovarian carcinoma patients with high alpha-folate receptor had reducing survival and cytotoxic chemo-response.
22089756 2012 Differential expression of folate receptor alpha in pituitary adenomas and its relationship to tumor behavior.
21938430 2012 A folate receptor alpha double-mutated haplotype 1816delC-1841A is distributed throughout Eurasia and associated with lower erythrocyte folate levels.
21647742 2012 The effect of chemotherapy on expression of folate receptor-alpha in ovarian cancer.
21572402 2011 Folate receptor-? expression in resectable hepatic colorectal cancer metastases: patterns and significance.
21215723 2011 Do folate-receptor targeted liposomal photosensitizers enhance photodynamic therapy selectivity?
21215165 2010 [Expression of folate receptor alpha in ovarian epithelial tumors].
21215055 2010 [Role of folate receptor 1 in paclitaxel-resistance of nasopharyngeal carcinoma cells].
20857335 2010 Progressive ataxia and myoclonic epilepsy in a patient with a homozygous mutation in the FOLR1 gene.
20817090 2010 Androgen activation of the folate receptor ? gene through partial tethering of the androgen receptor by C/EBP?.
20683905 2010 Association of folate receptor (FOLR1, FOLR2, FOLR3) and reduced folate carrier (SLC19A1) genes with meningomyelocele.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20424473 2010 L-type voltage-dependent calcium channel alpha subunit 1C is a novel candidate gene associated with secondary hyperparathyroidism: an application of haplotype-based analysis for multiple linked single nucleotide polymorphisms.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20037791 2010 Genes involved with folate uptake and distribution and their association with colorectal cancer risk.
20036773 2010 Expression of folate transporters in human placenta and implications for homocysteine metabolism.
19952865 2010 Autoantibodies to folate receptor alpha during early pregnancy and risk of oral clefts in Denmark.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19732866 2009 Folate receptor alpha defect causes cerebral folate transport deficiency: a treatable neurodegenerative disorder associated with disturbed myelin metabolism.
19617914 2009 Functional folate receptor alpha is elevated in the blood of ovarian cancer patients.
19585555 2010 Relationship between dietary and supplemental intake of folate, methionine, vitamin B6 and folate receptor alpha expression in ovarian tumors.
19581412 2009 Quantitative proteomics identifies a Dab2/integrin module regulating cell migration.
19493349 2009 118 SNPs of folate-related genes and risks of spina bifida and conotruncal heart defects.
19493312 2009 The critical role of alpha-folate receptor in the resistance of melanoma to methotrexate.
19454358 2009 Expression of the folate receptor genes FOLR1 and FOLR3 differentiates ovarian carcinoma from breast carcinoma and malignant mesothelioma in serous effusions.
19446551 2009 Folate receptor alpha regulates cell proliferation in mouse gonadotroph alphaT3-1 cells.
19336370 2009 Determination of genetic predisposition to patent ductus arteriosus in preterm infants.
19324355 2010 Variations in folate pathway genes are associated with unexplained female infertility.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
19161160 2009 An association study of 45 folate-related genes in spina bifida: Involvement of cubilin (CUBN) and tRNA aspartic acid methyltransferase 1 (TRDMT1).
19159907 2009 Methotrexate in pediatric osteosarcoma: response and toxicity in relation to genetic polymorphisms and dihydrofolate reductase and reduced folate carrier 1 expression.
19116913 2009 Folate receptor beta as a potential delivery route for novel folate antagonists to macrophages in the synovial tissue of rheumatoid arthritis patients.
19093297 2008 Interaction of genes from influx-metabolism-efflux pathway and their influence on methotrexate efficacy in rheumatoid arthritis patients among Indians.
19074442 2009 A role for the proton-coupled folate transporter (PCFT-SLC46A1) in folate receptor-mediated endocytosis.
19048631 2009 Oral facial clefts and gene polymorphisms in metabolism of folate/one-carbon and vitamin A: a pathway-wide association study.
18988749 2009 MALDI-TOF MS genotyping of polymorphisms related to 1-carbon metabolism using common and mass-modified terminators.
18780401 2008 Identification of N-linked glycoproteins in human milk by hydrophilic interaction liquid chromatography and mass spectrometry.
18588513 2008 alpha Isoforms of soluble and membrane-linked folate-binding protein in human blood.
18181001 2008 Expression status of folate receptor alpha is significantly correlated with prognosis in non-small-cell lung cancers.
17912458 2007 Mutations in exons 2 and 3 of the FOLR1 gene in demented and non-demented elderly subjects.
17566972 2007 Computational approach for identification and characterization of GPI-anchored peptides in proteomics experiments.
17554378 2007 Induction of folate receptor type beta in a bone marrow engraftment model of acute myelogenous leukemia.
17487842 2007 Folate receptor overexpression is associated with poor outcome in breast cancer.
17473184 2007 The folate receptor alpha is frequently overexpressed in osteosarcoma samples and plays a role in the uptake of the physiologic substrate 5-methyltetrahydrofolate.
17035141 2006 Neural tube defects and folate pathway genes: family-based association tests of gene-gene and gene-environment interactions.
16602701 2006 Modification-specific proteomics of plasma membrane proteins: identification and characterization of glycosylphosphatidylinositol-anchored proteins released upon phospholipase D treatment.
16475900 2006 Novel mutations in the 5'-UTR of the FOLR1 gene.
16453285 2006 The role of folate receptor alpha in cancer development, progression and treatment: cause, consequence or innocent bystander?
16128986 2005 A minor fraction of a high-affinity folate binding protein from the epididymis is associated with membranous vesicles and spermatozoa in human semen.
15754024 2005 Polymorphisms and mutations of the folate receptor-alpha gene and risk of gastric cancer in a Chinese population.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15340044 2004 Impaired CREB-1 phosphorylation in antifolate-resistant cell lines with down-regulation of the reduced folate carrier gene.
14972645 2004 Novel insertion and deletion mutations in the 5'-UTR of the folate receptor-alpha gene: an additional contributor to hyperhomocysteinemia?
14722620 2004 Translational upregulation of folate receptors is mediated by homocysteine via RNA-heterogeneous nuclear ribonucleoprotein E1 interactions.
14517339 2003 Proteomic analysis of glycosylphosphatidylinositol-anchored membrane proteins.
12839949 2003 Selective delivery of CB300638, a cyclopenta[g]quinazoline-based thymidylate synthase inhibitor into human tumor cell lines overexpressing the alpha-isoform of the folate receptor.
12612090 2003 mRNA instability in the nucleus due to a novel open reading frame element is a major determinant of the narrow tissue specificity of folate receptor alpha.
12516786 Ligand binding characteristics of two molecular forms, one equipped with a hydrophobic glycosyl phosphatidylinositol tail, of the folate binding protein purified from human milk.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11925593 2002 Construction of cDNA representational difference analysis based on two cDNA libraries and identification of garlic inducible expression genes in human gastric cancer cells.
10787414 2000 Expression and differential polarization of the reduced-folate transporter-1 and the folate receptor alpha in mammalian retinal pigment epithelium.
10633085 2000 Interaction of folate receptor with signaling molecules lyn and G(alpha)(i-3) in detergent-resistant complexes from the ovary carcinoma cell line IGROV1.
10025672 1999 Molecular requirements for attachment of the glycosylphosphatidylinositol anchor to the human alpha folate receptor.
9545095 1998 Lack of association between mutations in the folate receptor-alpha gene and spina bifida.
9063895 1997 The divergent 5' termini of the alpha human folate receptor (hFR) mRNAs originate from two tissue-specific promoters and alternative splicing: characterization of the alpha hFR gene structure.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8567728 1996 Endocytosis of GPI-linked membrane folate receptor-alpha.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
8061055 1994 Selective expression of the high-affinity isoform of the folate receptor (FR-alpha) in the human placental syncytiotrophoblast and choriocarcinoma cells.
8033114 1994 UMSCC38 cells amplified at 11q13 for the folate receptor synthesize a mutant nonfunctional folate receptor.
7632694 1995 Structural and functional analysis of the human KB cell folate receptor gene P4 promoter: cooperation of three clustered Sp1-binding sites with initiator region for basal promoter activity.
7578066 1995 Preferred sites of glycosylphosphatidylinositol modification in folate receptors and constraints in the primary structure of the hydrophobic portion of the signal.
3476960 1987 Purified membrane and soluble folate binding proteins from cultured KB cells have similar amino acid compositions and molecular weights but differ in fatty acid acylation.
3194438 1988 Molecular cloning of the complementary DNA for a human folate binding protein.
2768245 1989 Molecular cloning and characterization of the human folate-binding protein cDNA from placenta and malignant tissue culture (KB) cells.
2538429 1989 The complete amino acid sequence of a human folate binding protein from KB cells determined from the cDNA.
2527252 1989 Complementary DNA for the folate binding protein correctly predicts anchoring to the membrane by glycosyl-phosphatidylinositol.
2166548 1990 Folate-binding proteins.
1840502 1991 Cloning of a tumor-associated antigen: MOv18 and MOv19 antibodies recognize a folate-binding protein.
1717147 1991 Folate-binding protein is a marker for ovarian cancer.
1581364 1992 Genomic organization of the gene and a related pseudogene for a human folate binding protein.
1330883 1992 Genomic organization of the human folate receptor genes on chromosome 11q13.