Property Summary

NCBI Gene PubMed Count 7
PubMed Score 2218.97
PubTator Score 2.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Gene RIF (2)

AA Sequence

MGGSAPPDSSWRGSLKVSYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHR      1 - 70
DSWVFGGIDPQSGAAVVHETVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEDNSRLLQERGVA     71 - 140
YINADSSIEGNYTLRVDCTPLMYSLVYNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSG    141 - 210
NDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELA    211 - 280
NSIVLPFDCRDYAVVLRKYADKIYNISMKHPQEMKTYSLSFDSLFSAVKNFTEIASKFSERLQDFDKSNP    281 - 350
ILLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGDV    351 - 420
KRQISVAAFTVQAAAETLSEVA                                                    421 - 442
//

Text Mined References (7)

PMID Year Title