Property Summary

Ligand Count 192
NCBI Gene PubMed Count 161
PubMed Score 2218.97
PubTator Score 897.86

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
active ulcerative colitis 4.508 1.1e-02
adrenocortical carcinoma 1.122 6.0e-03
astrocytoma -1.100 9.8e-06
Astrocytoma, Pilocytic -1.400 2.6e-02
Breast cancer -2.200 3.4e-11
Down syndrome 1.400 1.2e-02
ependymoma -2.500 4.0e-02
group 4 medulloblastoma -2.300 2.6e-03
medulloblastoma, large-cell -1.500 3.2e-02
non-small cell lung cancer 1.418 3.3e-07
oligodendroglioma -1.300 6.8e-06
Pick disease -1.600 1.9e-02
progressive supranuclear palsy -2.100 1.0e-02
psoriasis 1.300 8.2e-46
subependymal giant cell astrocytoma -2.900 9.6e-04

PDB (63)

Gene RIF (136)

AA Sequence

MWNLLHETDSAVATARRPRWLCAGALVLAGGFFLLGFLFGWFIKSSNEATNITPKHNMKAFLDELKAENI      1 - 70
KKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFN     71 - 140
TSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFR    141 - 210
GNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYR    211 - 280
RGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTN    281 - 350
EVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFAS    351 - 420
WDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEG    421 - 490
KSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYE    491 - 560
LVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFD    561 - 630
SLFSAVKNFTEIASKFSERLQDFDKSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKY    631 - 700
AGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA                        701 - 750
//

Text Mined References (170)

PMID Year Title