Property Summary

NCBI Gene PubMed Count 154
PubMed Score 1856.31
PubTator Score 897.86

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
ependymoma -2.500 4.0e-02
astrocytoma -1.100 9.8e-06
oligodendroglioma -1.300 6.8e-06
group 4 medulloblastoma -2.300 2.6e-03
medulloblastoma, large-cell -1.500 3.2e-02
adrenocortical carcinoma 1.122 6.0e-03
non-small cell lung cancer 1.418 3.3e-07
active ulcerative colitis 4.508 1.1e-02
pilocytic astrocytoma -1.300 2.7e-02
subependymal giant cell astrocytoma -2.900 9.6e-04
Breast cancer -2.200 3.4e-11
Pick disease -1.600 1.9e-02
progressive supranuclear palsy -2.100 1.0e-02
Down syndrome 1.400 1.2e-02
psoriasis 1.300 8.2e-46

Synonym

Accession Q04609 A4UU12 A9CB79 B7Z312 B7Z343 D3DQS5 E9PDX8 O43748 Q16305 Q541A4 Q8TAY3 Q9NP15 Q9NYE2 Q9P1P8
Symbols PSM
FGCP
FOLH
GCP2
PSMA
mGCP
GCPII
NAALAD1
NAALAdase

Gene

PANTHER Protein Class (1)

PDB

1Z8L   2C6C   2C6G   2C6P   2CIJ   2JBJ   2JBK   2OOT   2OR4   2PVV   2PVW   2XEF   2XEG   2XEI   2XEJ   3BHX   3BI0   3BI1   3BXM   3D7D   3D7F   3D7G   3D7H   3IWW   3RBU   3SJE   3SJF   3SJG   3SJX   4JYW   4JZ0   4LQG   4MCP   4MCQ   4MCR   4MCS   4NGM   4NGN   4NGP   4NGQ   4NGR   4NGS   4NGT   4OC0   4OC1   4OC2   4OC3   4OC4   4OC5   4OME   4P44   4P45   4P4B   4P4D   4P4E   4P4F   4P4I   4P4J   4W9Y   4X3R   5D29   5ELY   5F09  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (129)

PMID Text
27358992 Data show that the expressed antibody could specifically bind to prostate-specific membrane antigen ( PSMA) positive cells.
26977010 MDM2 and PSMA may co-regulate the expression of certain MMPs and, thus, the functionality of cells in metastatic breast cancer.
26771706 prostate-specific membrane antigen is significantly overexpressed in adrenocortical carcinoma neovasculature when compared with normal and benign adrenal tumors
26723876 Ad5/35E1aPSESE4 is effective in marking PSA/PSMA-positive prostate cancer cells in patient blood to improve the efficacy of utilizing CTCs as a biomarker.
26471812 Results from genetic models highlight the importance of GCPII genetic variants as relatively novel risk factors for breast cancer and prostate cancer.
26438155 Systemic treatment with these radiation-sensitizing agents selectively enhanced the potency of external beam radiation therapy for established PSMA-positive tumors.
26212031 evaluated the relaxometric properties of these agents in solution, in prostate cancer cells, and in an in vivo experimental model to demonstrate the feasibility of PSMA-based MR molecular imaging
26125931 In vitro immunotherapy is described for anti-prostate cancer effects of cytotoxic T lymphocytes induction by recombinant adenovirus mediated PSMA/4-1BBL dendritic cells.
26079448 This study demonstrated that Overexpression and Nucleolar Localization gcp2 in glioblastoma.
26028103 The findings suggest that C1561T-GCPII variation may be associated with risk for adenomatous polyp, and vitamin C may modify risk by interacting with the variant gene, its expression product and/or folate substrates.
25916744 First evidence of PSMA expression in differentiated thyroid cancer using [Ga]PSMA-HBED-CC PET/CT.
24939622 Taken together, this study demonstrated that the increase in GCPII induced by VPA is not due to the classical epigenetic mechanism, but via enhanced acetylation of lysine residues in GCPII.
24788382 we focus on the susceptibilities of these PSA-PSMA prostate clones to factors that promote prostate hyperplastic, neoplastic and metastatic development
24764162 This study demonstrates the feasibility of D2B IgG, F(ab')2 and Fab fragments for targeting PSMA-expressing prostate cancer xenografts.
24762500 PSMA expression may be correlated with nanog's expression as well as with other confounders in a population of prostate CSCs.
24477651 High glutamate carboxypeptidase II levels are associated with pancreatic cancer.
24424840 our data may suggest a new role for PSMA in prostate cancer progression, and provide opportunities for developing non-invasive approaches for diagnosis or prognosis of prostate cancer
24304465 Tumor-associated vasculature was PSMA-positive in 74% of primary breast cancers and in 100% of breast cancers metastatic to brain. PSMA was not detected in normal breast tissue. No significant association was seen between PSMA and lymph node involvement.
24292502 High glutamate carboxypeptidase II mRNA expression is associated with pelvic lymph node micrometastasis in prostate cancer.
24130224 High tumor PSMA expression was not an independent predictor of lethal prostate cancer in the current study.
24063616 The increase in gene expression ratio of PSA:PSMA to about 4.95 strongly correlated with the prostate cancer and with high intratumoral angiogenesis.
24063417 Data suggest the importance of an aromatic group and succinimide moiety for high affinity of probes with prostate-specific membrane antigen (PSMA)
23991415 Taking into account the PC phenotypes according to RKIP among PSA-PSMA profiles may improve distinguishing them from cancers that will become more aggressive.
23979608 the impact of Glutamate carboxypeptidase II (GCPII) haplotypes on the expression of PSMA, BNIP3, Ec-SOD, GSTP1 and RASSF1 genes were elucidated to understand the epigenetic basis of oxidative stress and prostate cancer risk.
23891752 These data suggest that GCPII has two distinctive binding sites for two different substrates and that ABETA degradation occurs through binding to S1 pocket of GCPII.
23775497 PSMA is part of a proteolytic cascade where it acts downstream of MMP-2 to create small pro-angiogenic laminin peptides.
23525279 Data did not show any amyloid-beta (Abeta) peptide degradation activity of glutamate carboxypeptidase II (GCPII).
23525278 Data indicate that glutamate carboxypeptidase II (GCPII) is not an amyloid peptide-degrading enzyme.
23467813 Folate plus vitamin B12 supplementation can improve negative symptoms of schizophrenia, but treatment response is influenced by FOLH1 genetic variation in folate absorption.
23359458 Canine PSMA reveals similar characteristics to human PSMA rendering this protein useful as a translational model for investigations of prostate cancer as well as a suitable antigen for targeted therapy studies in dogs.
23266799 The D191V variant increases breast cancer risk by affecting plasma folate. V108A and P160S variants reduce breast cancer risk. V108A and G245S varients are associated with prostate cancer risk.
23259322 To conclude, GCPII haplotypes influenced susceptibility to stroke by influencing homocysteine levels.
23041906 androgen-deprivation induced a decrease in AR and PSMA levels in androgen-sensitive LNCaP cells, which may be associated with the development of more aggressive disease-state following androgen deprivation therapy.
22568207 The survivin promoter exhibited a higher transcriptional activity than PSMA promoter and enhancer in prostate tumor cell lines.
22460809 High expression of prostate-specific membrane antigen in the tumor-associated neo-vasculature is associated with worse prog-nosis in squamous cell carcinoma of the oral cavity.
22322627 The PSM-E splice variant of PSMA suppression effect on cell proliferation is stronger compared to PSMA and the suppression effect on invasiveness is weaker than that of PSMA.
22310383 Statistically significant association was not observed between dietary folate levels and GCPII expression.
22304713 An overview of GCPII/PSMA in cancer, as well as a discussion of imaging and therapy of prostate cancer using a wide variety of PSMA-targeting agents is provided. [review]
22124883 Glutamate carboxypeptidase II gene combined AG GG rs202676 genotype was significantly associated with anencephaly, but not with spina bifida or encephalocele. Overall, the rs202676 A>G polymorphism is a potential risk factor for anencephaly.
22032578 Prostate-specific membrane antigen is expressed in the vasculature of glioblastoma multiforme vessels, thus rendering a potential novel therapeutic vascular target.
22009216 PSMA could be used as an independent prognostic marker for the osteosarcoma patients
21725290 The finding of PSMA in the bladder cancer neovasculature suggests that this molecule may promote tumor growth and may represent a potential new vascular target in this disease.
21640619 Data suggest the radioimmunoscintigraphic detection of radiolabeled prostate specific membrane antigen (PSMA antibodies might not be entirely specific for prostatic cells
21606347 Results establish that relative changes in PSMA expression levels can be quantitatively measured and could serve as a biomarker of AR signaling to noninvasively evaluate AR activity in patients with CRPC.
21604260 Data show that the full-length PSMA sequence containing all three epitopes was poorly immunogenic, but only those against PSMA(27) or PSMA(663) peptides, and not PSMA(711) , were able to kill tumor cells expressing endogenous PSMA.
21600799 Data indicate that PSA, PSMA, hK2, PSCA, DD3, and their combinations, combined analysis of PSA and/or hK2 expression in pelvic lymph nodes could predict biochemical recurrence free survival (BRFS) following radical prostatectomy (RP).
21597034 The FOLH1 1561C>T polymorphism may be associated with the risk of depressive symptoms.
21189143 PSMA and PSA are regulated differentially and the difference in their expression showed a correlation with malignant transformation
20852008 Observational study of gene-disease association. (HuGE Navigator)
20670952 Data show that the selected virus preferentially infects PSMA-expressing cells through the targeting peptide and infects LNCaP tumors after intravenous injection.
20634891 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20624932 important physiological role for GCPII in Abeta clearance in brain and provide the evidence that dysregulation of GCPII is involved in Alzheimer's disease pathology
20458436 Observational study of gene-disease association. (HuGE Navigator)
20452657 These results suggest that a specific antitumor immune response is enhanced by DNA vaccines expressing PSMA
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20047525 parental C1561T polymorphism associated with increased risk for neural tube defects
20047525 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19936946 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19776634 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19716160 PSMA represents a promising therapeutic and diagnostic target in colorectal and gastric cancer.
19706844 Meta-analysis of gene-disease association. (HuGE Navigator)
19427504 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19403271 These data suggest that Glutamate carboxypeptidase II is disrupted in the AH in schizophrenia and localize the defect to the CA1 and CA3 regions.
19394322 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19343734 PSMA and prostate stem cell antigen are both highly expressed in lymph node and bone metastases of prostate cancer.
19301871 Reaction mechanisms of GCPII revealed by mutagenesis, X-ray crystallography, and computational methods.
19242540 PSMA-fostered RAS-RAC1-MAPK pathway activation produced a strong induction of NF-kappaB activation associated with an increased expression of IL-6 and CCL5 genes.
19172696 although the RFC1 80G > A and FOLH1 1561C > T polymorphisms may influence folate status, they are not likely to have a major independent role in the development of colorectal cancer
19172696 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19161160 Observational study of gene-disease association. (HuGE Navigator)
19107881 PSM' protein is likely not generated by alternative splicing of the PSMA gene but by different mechanism, probably via an endoproteolytic cleavage of the full-length PSMA.
19060911 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19053759 analysis of interactions between human glutamate carboxypeptidase II and urea-based inhibitors
19048631 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18974153 Ectopic PSMA expression on PC-3 cells increased the invasive capacity of cells in in vitro invasion assays, which could be competed out by folic acid. These results suggest PSMA facilitates the development of prostate cancer
18844933 PSMA was the most useful marker to identify residual prostatic carcinoma after hormone therapy.
18842806 Observational study of gene-disease association. (HuGE Navigator)
18839017 prostate-specific membrane antigen is expressed in neovasculature from physiologic regenerative and reparative conditions
18823966 Neonatal methylmalonic acid was predicted by maternal methylmalonic acid and GCPII
18823966 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18639471 The present study describes an efficient RNAi system for gene silencing that is specific to prostate cancer cells using the PSMA promoter/enhancer
18635682 Observational study of gene-disease association. (HuGE Navigator)
18626508 the efficacy of 5-FU-based chemotherapy in prostate cancers can be significantly improved by targeted expression of the suicide gene UPRT under the control of prostate-specific membrane antigen promoter/enhancer
18590621 Observational study and meta-analysis of genotype prevalence. (HuGE Navigator)
18534872 Given our finding of frequent expression of PSMA in Schwannomas, they should be clinically considered in the differential diagnosis of a lesion that is positive on PSMA radioimmunoscintigraphy study performed during a metastatic work-up of PCa patient.
18427977 Observational study of genetic testing. (HuGE Navigator)
18349274 PSMA is underexpressed in advanced stage endometrial adenocarcinoma (EAC); loss of PSMA expression can be considered as a prognostic marker in patients with EAC; loss of PSMA expression in a subset of EAC cases could be due to epigenetic silencing
18344976 prostate-specific membrane antigen is expressed in tumor-associated neovasculature of the majority of renal cortical tumors
18249021 Observational study of gene-disease association. (HuGE Navigator)
18234225 Crystal structures of human GCPII in complex with phosphapeptide analogs show the S1 pocket of GCPII and the data indicate the importance of Asn519, Arg463, Arg534, and Arg536 for recognition of the penultimate (i.e., P1) substrate residues.
18076021 Tissues such as prostate and testes exhibit different GCPII expression levels among the species studied (human, rats, swine).
17935484 the intracellular transport of PSMA occurs through populations of DRMs distinct for each biosynthetic form and cellular compartment
17714508 the residues forming the S1 pocket might be more important for the 'fine-tuning' of GCPII substrate specificity
17689503 Pattern differences in GCP II gene promoter expression in SVG and LNCaP cells suggest that sequences beyond 240 bp may be important for tissue-specific GCP II expression.
17684227 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17684227 Polymorphism is associated with higher plasma folate and lower homocysteine concentrations in women who abstain from alcohol.
17208363 Observational study of gene-disease association. (HuGE Navigator)
17150306 Using pure recombinant GCPII and homologous GCPIII, we conclude that GCPII is responsible for the majority of overall NAAG-hydrolyzing activity in the human brain.
17032155 In suicide gene therapy, anti-PSMA-liposome complex exerted a significant inhibitory effect on the growth of LNCaP xenograft, in contrast to normal IgG-liposome complex.
16713605 PSMA binds to caveolin-1 and undergoes internalization via a caveolae-dependent mechanism in microvascular endothelial cells
16522921 Observational study of gene-disease association. (HuGE Navigator)
16496414 The folate hydrolase activity of PSMA may provide a growth advantage to prostate cancer cells in low folate and physiological folate environments.
16221666 acquisition of folding determinants in the Golgi is an essential prerequisite for protein trafficking and sorting of PSMA
15840561 PSMA may function as a receptor internalizing a putative ligand, an enzyme playing a role in nutrient uptake, and a peptidase involved in signal transduction in prostate epithelial cells. [review]
15837926 Structure and relevance to the development of chemotherapeutics and cancer-imaging agents.
15713827 Transcriptional activity of the PSMA promoter/enhancer is prostate specific.
15705868 Knockdown of PSMA expression increased invasiveness of LNCaP cells by 5-fold.
15389976 PSMA gene lacks specificity for detecting prostate epithelial cells
15321811 Clinical trial of gene-environment interaction. (HuGE Navigator)
15206943 amino acid segments at the N- and C-termini of the ectodomain of GCPII are essential for its carboxypeptidase activity and/or proper folding
15152093 Analysis of the predicted N-glycosylation sites also provides evidence that these sites are critical for GCPII carboxypeptidase activity
15141017 proteins binding PSMA
15122597 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
14632302 Observational study of genotype prevalence. (HuGE Navigator)
14528023 PSMA is internalized via a clathrin-dependent endocytic mechanism and that internalization of PSMA is mediated by the five N-terminal amino acids
12949938 N-linked carbohydrate structures are important for the folate hydrolase function of the protein. Removal of sugars partially or completely causes PSMA to be enzymatically inactive, improperly folded, resulting in increased rate of degradation.
12855225 Observational study of gene-disease association. (HuGE Navigator)
12850144 PSMA expression is regulated by NFATc1 with an AP-3 binding site
12753319 Observational study of gene-disease association. (HuGE Navigator)
12753319 GCP2 1561C>T is associated with elevated folate levels but not homocysteine levels in kidney transplant patients
12707400 Observational study of gene-disease association. (HuGE Navigator)
12707400 GCP2 polymorphism explained nearly 50% of the variance of red blood cell folate in ESRD
12514270 Observational study of gene-disease association. (HuGE Navigator)
12474535 expressed in prostate tissue, and especially in prostate cancer tissue
12204797 Observational study of gene-disease association. (HuGE Navigator)
12042430 Observational study of gene-disease association. (HuGE Navigator)
11092759 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MWNLLHETDSAVATARRPRWLCAGALVLAGGFFLLGFLFGWFIKSSNEATNITPKHNMKAFLDELKAENI      1 - 70
KKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFN     71 - 140
TSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFR    141 - 210
GNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYR    211 - 280
RGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTN    281 - 350
EVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFAS    351 - 420
WDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEG    421 - 490
KSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYE    491 - 560
LVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFD    561 - 630
SLFSAVKNFTEIASKFSERLQDFDKSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKY    631 - 700
AGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA                        701 - 750
//

Text Mined References (163)

PMID Year Title
27358992 2016 [Domestication of suspension CHO cells and its application in the expression of anti-PSMA antibody].
26977010 2016 MDM2 and PSMA Play Inhibitory Roles in Metastatic Breast Cancer Cells Through Regulation of Matrix Metalloproteinases.
26771706 2016 Prostate-Specific Membrane Antigen Is a Potential Antiangiogenic Target in Adrenocortical Carcinoma.
26723876 2016 Ad5/35E1aPSESE4: A novel approach to marking circulating prostate tumor cells with a replication competent adenovirus controlled by PSA/PSMA transcription regulatory elements.
26471812 2015 Clinical utility of genetic variants of glutamate carboxypeptidase II in predicting breast cancer and prostate cancer risk.
26438155 2015 Systemic Administration and Targeted Radiosensitization via Chemically Synthetic Aptamer-siRNA Chimeras in Human Tumor Xenografts.
26212031 2015 Synthesis and Evaluation of Gd(III) -Based Magnetic Resonance Contrast Agents for Molecular Imaging of Prostate-Specific Membrane Antigen.
26125931 2015 Anti-prostate cancer effects of CTL cell induction in vitro by recombinant adenovirus mediated PSMA/4-1BBL dendritic cells: an immunotherapy study.
26079448 2015 Overexpression and Nucleolar Localization of ?-Tubulin Small Complex Proteins GCP2 and GCP3 in Glioblastoma.
26028103 2015 Genetic Variation in Glutamate Carboxypeptidase II and Interaction with Dietary Natural Vitamin C May Predict Risk for Adenomatous Polyp Occurrence.
25916744 2015 First evidence of PSMA expression in differentiated thyroid cancer using [??Ga]PSMA-HBED-CC PET/CT.
24939622 2014 Acetylation regulates the stability of glutamate carboxypeptidase II protein in human astrocytes.
24863754 2014 Structural and biochemical characterization of the folyl-poly-?-l-glutamate hydrolyzing activity of human glutamate carboxypeptidase II.
24788382 2014 Insight into the heterogeneity of prostate cancer through PSA-PSMA prostate clones: mechanisms and consequences.
24764162 Targeting human prostate cancer with 111In-labeled D2B IgG, F(ab')2 and Fab fragments in nude mice with PSMA-expressing xenografts.
24762500 How prostate-specific membrane antigen level may be correlated with stemness in prostate cancer stem cell-like cell populations?
24477651 2014 Prostate-specific membrane antigen as a marker of pancreatic cancer cells.
24424840 2014 Functional prostate-specific membrane antigen is enriched in exosomes from prostate cancer cells.
24304465 2014 Prostate-specific membrane antigen expression in tumor-associated vasculature of breast cancers.
24292502 2014 Detection of pelvic lymph node micrometastasis by real-time reverse transcriptase polymerase chain reaction in prostate cancer patients after hormonal therapy.
24130224 2013 Prostate-specific membrane antigen protein expression in tumor tissue and risk of lethal prostate cancer.
24063616 2014 PSMA/PSA ratio evaluated by immunohistochemistry may improve diagnosis of prostate cancer.
24063417 2013 Preparation of asymmetric urea derivatives that target prostate-specific membrane antigen for SPECT imaging.
23991415 2013 A comparison of the biological features of prostate cancer with (PSA+, PSMA+) profile according to RKIP.
23979608 2013 GCPII modulates oxidative stress and prostate cancer susceptibility through changes in methylation of RASSF1, BNIP3, GSTP1 and Ec-SOD.
23891752 2013 S1 pocket of glutamate carboxypeptidase II: a new binding site for amyloid-? degradation.
23775497 2013 Prostate specific membrane antigen produces pro-angiogenic laminin peptides downstream of matrix metalloprotease-2.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23525279 2013 Glutamate carboxypeptidase II does not process amyloid-? peptide.
23525278 2013 Glutamate carboxypeptidase II is not an amyloid peptide-degrading enzyme.
23467813 2013 Randomized multicenter investigation of folate plus vitamin B12 supplementation in schizophrenia.
23359458 2013 Cloning and characterization of canine prostate-specific membrane antigen.
23266799 2013 Association of glutamate carboxypeptidase II (GCPII) haplotypes with breast and prostate cancer risk.
23259322 2012 Glutamate carboxypeptidase II (GCPII) genetic variants as determinants of hyperhomocysteinemia: implications in stroke susceptibility.
23041906 2012 Prolonged androgen deprivation leads to downregulation of androgen receptor and prostate-specific membrane antigen in prostate cancer cells.
22568207 2012 [Transcriptional activities of tumor-specific survivin promoter and PSMA promoter and enhancer in human prostate cancer: evaluation and comparison].
22460809 2012 High expression of prostate-specific membrane antigen in the tumor-associated neo-vasculature is associated with worse prognosis in squamous cell carcinoma of the oral cavity.
22322627 2012 New alternatively spliced variant of prostate-specific membrane antigen PSM-E suppresses the proliferation, migration and invasiveness of prostate cancer cells.
22310383 2012 Paradoxical role of C1561T glutamate carboxypeptidase II (GCPII) genetic polymorphism in altering disease susceptibility.
22304713 2012 GCPII imaging and cancer.
22124883 2012 Glutamate carboxypeptidase II gene polymorphisms and neural tube defects in a high-risk Chinese population.
22032578 2011 Prostate-specific membrane antigen as a potential novel vascular target for treatment of glioblastoma multiforme.
22009216 2012 Prostate-specific membrane antigen: a new potential prognostic marker of osteosarcoma.
21725290 2011 Folate hydrolase (prostate-specific membrane [corrected] antigen) 1 expression in bladder cancer subtypes and associated tumor neovasculature.
21640619 2013 Focal positive prostate-specific membrane antigen (PSMA) expression in ganglionic tissues associated with prostate neurovascular bundle: implications for novel intraoperative PSMA-based fluorescent imaging techniques.
21606347 2011 Noninvasive measurement of androgen receptor signaling with a positron-emitting radiopharmaceutical that targets prostate-specific membrane antigen.
21604260 2011 DNA fusion gene vaccines induce cytotoxic T-cell attack on naturally processed peptides of human prostate-specific membrane antigen.
21600799 2013 Assessment of optimal target genes for detecting micrometastases in pelvic lymph nodes in patients with prostate cancer undergoing radical prostatectomy by real-time reverse transcriptase-polymerase chain reaction.
21597034 2011 The folate hydrolase 1561C>T polymorphism is associated with depressive symptoms in Puerto Rican adults.
21189143 2010 Co-expression and impact of prostate specific membrane antigen and prostate specific antigen in prostatic pathologies.
20881960 2010 Hundreds of variants clustered in genomic loci and biological pathways affect human height.
20852008 2010 Associations of folate, vitamin B12, homocysteine, and folate-pathway polymorphisms with prostate-specific antigen velocity in men with localized prostate cancer.
20670952 2010 Adenovirus targeting to prostate-specific membrane antigen through virus-displayed, semirandom peptide library screening.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20624932 2010 Glutamate carboxypeptidase II: an amyloid peptide-degrading enzyme with physiological function in the brain.
20458436 2010 Early-onset ischaemic stroke: analysis of 58 polymorphisms in 17 genes involved in methionine metabolism.
20452657 2010 Antitumor immune response induced by DNA vaccine encoding human prostate-specific membrane antigen and mouse 4-1BBL.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20047525 2010 Role of parental folate pathway single nucleotide polymorphisms in altering the susceptibility to neural tube defects in South India.
19936946 2010 Germline polymorphisms in the one-carbon metabolism pathway and DNA methylation in colorectal cancer.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19776634 2009 Folate nutritional genetics and risk for hypertension in an elderly population sample.
19716160 2009 Prostate-specific membrane antigen expression in the neovasculature of gastric and colorectal cancers.
19706844 2009 Association of folate-pathway gene polymorphisms with the risk of prostate cancer: a population-based nested case-control study, systematic review, and meta-analysis.
19678840 2009 Structural insight into the evolutionary and pharmacologic homology of glutamate carboxypeptidases II and III.
19427504 2009 Effect of common polymorphisms in folate uptake and metabolism genes on frequency of micronucleated lymphocytes in a South Australian cohort.
19403271 2009 Localization of NAAG-related gene expression deficits to the anterior hippocampus in schizophrenia.
19394322 2009 Genetic and environmental influences on total plasma homocysteine and coronary artery disease (CAD) risk among South Indians.
19343734 2009 Expression of the gastrin-releasing peptide receptor, the prostate stem cell antigen and the prostate-specific membrane antigen in lymph node and bone metastases of prostate cancer.
19301871 2009 Reaction mechanism of glutamate carboxypeptidase II revealed by mutagenesis, X-ray crystallography, and computational methods.
19242540 2009 The prostate specific membrane antigen regulates the expression of IL-6 and CCL5 in prostate tumour cells by activating the MAPK pathways.
19172696 2008 The reduced folate carrier (RFC1) 80G > A and folate hydrolase 1 (FOLH1) 1561C > T polymorphisms and the risk of colorectal cancer: a nested case-referent study.
19161160 2009 An association study of 45 folate-related genes in spina bifida: Involvement of cubilin (CUBN) and tRNA aspartic acid methyltransferase 1 (TRDMT1).
19107881 2009 Prostate-specific membrane antigen and its truncated form PSM'.
19060911 2009 Loci influencing lipid levels and coronary heart disease risk in 16 European population cohorts.
19053759 2008 Interactions between human glutamate carboxypeptidase II and urea-based inhibitors: structural characterization.
19048631 2009 Oral facial clefts and gene polymorphisms in metabolism of folate/one-carbon and vitamin A: a pathway-wide association study.
18974153 2008 Moderate expression of prostate-specific membrane antigen, a tissue differentiation antigen and folate hydrolase, facilitates prostate carcinogenesis.
18844933 2008 Immunohistochemical detection of carcinoma in radical prostatectomy specimens following hormone therapy.
18842806 2008 Associations between single nucleotide polymorphisms in folate uptake and metabolizing genes with blood folate, homocysteine, and DNA uracil concentrations.
18839017 2008 Prostate-specific membrane antigen expression in regeneration and repair.
18823966 2008 Relationships between gene polymorphisms of folate-related proteins and vitamins and metabolites in pregnant women and neonates.
18639471 Tissue-selective RNA interference in prostate cancer cell using prostate specific membrane antigen promoter/enhancer.
18635682 2008 Genetic analysis of 56 polymorphisms in 17 genes involved in methionine metabolism in patients with abdominal aortic aneurysm.
18626508 2009 Specific targeting of prostate cancer cells in vitro by the suicide gene/prodrug system, uracil phosphoribosyltransferase/5-fluorouracil, under the control of prostate-specific membrane antigen promoter/enhancer.
18590621 2008 [Analysis of the frequencies of genotype combinations of 4 polymorphisms of genes acting on the folate cycle in the Spanish population].
18534872 PSMA expression in Schwannoma: a potential clinical mimicker of metastatic prostate carcinoma.
18427977 2008 High-throughput multiplex single-nucleotide polymorphism (SNP) analysis in genes involved in methionine metabolism.
18349274 2008 Prostate-specific membrane antigen expression is a potential prognostic marker in endometrial adenocarcinoma.
18344976 2008 Expression of prostate-specific membrane antigen in renal cortical tumors.
18249021 2008 Total homocysteine, B-vitamins and genetic polymorphisms in patients with classical phenylketonuria.
18234225 2008 Structural basis of interactions between human glutamate carboxypeptidase II and its substrate analogs.
18076021 2008 Tissue expression and enzymologic characterization of human prostate specific membrane antigen and its rat and pig orthologs.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17935484 2008 Different glycoforms of prostate-specific membrane antigen are intracellularly transported through their association with distinct detergent-resistant membranes.
17929272 2007 High expression of PSM-E correlated with tumor grade in prostate cancer: a new alternatively spliced variant of prostate-specific membrane antigen.
17714508 2007 Mapping of the active site of glutamate carboxypeptidase II by site-directed mutagenesis.
17689503 2007 Promoter analysis of human glutamate carboxypeptidase II.
17684227 2007 Relations of glutamate carboxypeptidase II (GCPII) polymorphisms to folate and homocysteine concentrations and to scores of cognition, anxiety, and depression in a homogeneous Norwegian population: the Hordaland Homocysteine Study.
17567119 2007 Structural insight into the pharmacophore pocket of human glutamate carboxypeptidase II.
17372356 2007 Human glutamate carboxypeptidase II inhibition: structures of GCPII in complex with two potent inhibitors, quisqualate and 2-PMPA.
17241121 2007 Biochemical characterization of human glutamate carboxypeptidase III.
17208363 2007 Gene polymorphisms of folate metabolizing enzymes and the risk of gastric cancer.
17150306 2007 Expression of glutamate carboxypeptidase II in human brain.
17032155 2006 Targeting gene therapy for prostate cancer cells by liposomes complexed with anti-prostate-specific membrane antigen monoclonal antibody.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16713605 Association of prostate-specific membrane antigen with caveolin-1 and its caveolae-dependent internalization in microvascular endothelial cells: implications for targeting to tumor vasculature.
16555021 2006 Expression of prostate-specific membrane antigen in normal and malignant human tissues.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16522921 2006 Interactions among polymorphisms in folate-metabolizing genes and serum total homocysteine concentrations in a healthy elderly population.
16496414 2006 Prostate specific membrane antigen (PSMA) expression gives prostate cancer cells a growth advantage in a physiologically relevant folate environment in vitro.
16467855 2006 Structure of glutamate carboxypeptidase II, a drug target in neuronal damage and prostate cancer.
16221666 2006 Apical transport and folding of prostate-specific membrane antigen occurs independent of glycan processing.
15840561 2005 Is prostate-specific membrane antigen a multifunctional protein?
15837926 2005 Crystal structure of prostate-specific membrane antigen, a tumor marker and peptidase.
15713827 Construction of prostate-specific expressed recombinant plasmids with high transcriptional activity of prostate-specific membrane antigen (PSMA) promoter/enhancer.
15705868 2005 Novel role of prostate-specific membrane antigen in suppressing prostate cancer invasiveness.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15389976 2004 Correspondence re: Ghosh A and Heston WDW. Tumor target prostate specific membrane antigen (PSMA) and its regulation in prostate cancer. J Cell Biochem 91:528-539, 2004.
15321811 2004 Bioavailability of polyglutamyl folic acid relative to that of monoglutamyl folic acid in subjects with different genotypes of the glutamate carboxypeptidase II gene.
15206943 2004 Amino acids at the N- and C-termini of human glutamate carboxypeptidase II are required for enzymatic activity and proper folding.
15152093 2004 Identification of the N-glycosylation sites on glutamate carboxypeptidase II necessary for proteolytic activity.
15141017 2004 Disulfide-constrained peptides that bind to the extracellular portion of the prostate-specific membrane antigen.
15122597 2004 Polymorphisms in the one-carbon metabolic pathway, plasma folate levels and colorectal cancer in a prospective study.
14716746 2004 Comparative analysis of prostate-specific membrane antigen (PSMA) versus a prostate-specific membrane antigen-like gene.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14632302 2003 Genotype frequencies and linkage disequilibrium in the CEPH human diversity panel for variants in folate pathway genes MTHFR, MTHFD, MTRR, RFC1, and GCP2.
14571414 2003 Targeted systemic therapy of prostate cancer with a monoclonal antibody to prostate-specific membrane antigen.
14528023 2003 A novel cytoplasmic tail MXXXL motif mediates the internalization of prostate-specific membrane antigen.
13678295 2003 Recombinant glutamate carboxypeptidase II (prostate specific membrane antigen--PSMA)--cellular localization and bioactivity analyses.
12949938 2003 Effect of carbohydrate moieties on the folate hydrolysis activity of the prostate specific membrane antigen.
12949815 2003 Expression of prostate specific membrane antigen and three alternatively spliced variants of PSMA in prostate cancer patients.
12855225 2003 Evaluation of genetic variants in the reduced folate carrier and in glutamate carboxypeptidase II for spina bifida risk.
12850144 2003 NFATc1 with AP-3 site binding specificity mediates gene expression of prostate-specific-membrane-antigen.
12754519 2003 Identification and quantification of N-linked glycoproteins using hydrazide chemistry, stable isotope labeling and mass spectrometry.
12753319 2003 Effects of the glutamate carboxypeptidase II (GCP2 1561C>T) and reduced folate carrier (RFC1 80G>A) allelic variants on folate and total homocysteine levels in kidney transplant patients.
12712410 2003 Expression pattern of mouse homolog of prostate-specific membrane antigen (FOLH1) in the transgenic adenocarcinoma of the mouse prostate model.
12707400 2003 Effect of glutamate carboxypeptidase II and reduced folate carrier polymorphisms on folate and total homocysteine concentrations in dialysis patients.
12514270 2003 The H475Y polymorphism in the glutamate carboxypeptidase II gene increases plasma folate without affecting the risk for neural tube defects in humans.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12474535 The clinical role of prostate-specific membrane antigen (PSMA).
12210356 2002 Studies with His475Tyr glutamate carboxipeptidase II polymorphism and neural tube defects.
12204797 2002 Influence of a glutamate carboxypeptidase II (GCPII) polymorphism (1561C-->T) on plasma homocysteine, folate and vitamin B(12) levels and its relationship to cardiovascular disease risk.
12042430 2002 The glutamate carboxypeptidase gene II (C>T) polymorphism does not affect folate status in the Framingham Offspring cohort.
11102961 2000 Prostate-specific membrane antigen (PSMA) enzyme activity is elevated in prostate cancer cells.
11092759 2000 Glutamate carboxypeptidase II: a polymorphism associated with lower levels of serum folate and hyperhomocysteinemia.
10085079 1999 Isolation and expression of novel human glutamate carboxypeptidases with N-acetylated alpha-linked acidic dipeptidase and dipeptidyl peptidase IV activity.
9882712 1999 Site-directed mutagenesis of predicted active site residues in glutamate carboxypeptidase II.
9838072 1998 Mapping, genomic organization and promoter analysis of the human prostate-specific membrane antigen gene.
9816319 1996 Prostate-specific membrane antigen: a novel folate hydrolase in human prostatic carcinoma cells.
9809977 1998 Identification, purification, and subcellular localization of prostate-specific membrane antigen PSM' protein in the LNCaP prostatic carcinoma cell line.
9694964 1998 Molecular characterization of human brain N-acetylated alpha-linked acidic dipeptidase (NAALADase).
9691167 1998 Detailed genetic mapping around a putative prostate-specific membrane antigen locus on human chromosome 11p11.2.
9622670 1998 Hydrolysis of the neuropeptide N-acetylaspartylglutamate (NAAG) by cloned human glutamate carboxypeptidase II.
9375657 1997 Molecular cloning of a peptidase against N-acetylaspartylglutamate from a rat hippocampal cDNA library.
9187245 1997 Structure of membrane glutamate carboxypeptidase.
8595888 1995 Localization and physical mapping of the prostate-specific membrane antigen (PSM) gene to human chromosome 11.
8570628 1996 Prostate-specific membrane antigen is a hydrolase with substrate and pharmacologic characteristics of a neuropeptidase.
8417812 1993 Molecular cloning of a complementary DNA encoding a prostate-specific membrane antigen.
7882349 1995 Alternatively spliced variants of prostate-specific membrane antigen RNA: ratio of expression as a potential measurement of progression.
7665226 1995 Detection and characterization of the prostate-specific membrane antigen (PSMA) in tissue extracts and body fluids.
7511053 1994 Expression of the prostate-specific membrane antigen.