Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.00

Knowledge Summary


No data available


  Disease (1)

Disease Target Count P-value
ependymoma 2514 2.3e-03


  Differential Expression (1)

Disease log2 FC p
ependymoma 1.300 2.3e-03

AA Sequence

FTIKRAETSTLVYEPWRDSLTLHTKPEPLEGPALSHSV                                    281 - 318

Text Mined References (7)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23535732 2013 Identification of 23 new prostate cancer susceptibility loci using the iCOGS custom genotyping array.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.