Property Summary

NCBI Gene PubMed Count 15
PubMed Score 4.88
PubTator Score 4.06

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
interstitial lung disease 1.200 2.0e-02
Waldenstrons macroglobulinemia 1.062 3.3e-03
Multiple myeloma 1.173 2.1e-03
astrocytic glioma 1.900 7.2e-03
ependymoma 2.000 5.3e-03
oligodendroglioma 2.200 3.3e-03
osteosarcoma 3.635 2.9e-08
atypical teratoid / rhabdoid tumor 1.200 2.2e-03
glioblastoma 1.100 2.2e-02
primitive neuroectodermal tumor 1.700 3.5e-04
pancreatic ductal adenocarcinoma liver m... 1.435 4.4e-02
intraductal papillary-mucinous adenoma (... 1.500 2.3e-04
intraductal papillary-mucinous carcinoma... 1.200 3.6e-03
lung cancer 1.400 1.1e-03
breast carcinoma 1.100 1.8e-02
group 3 medulloblastoma 1.100 1.2e-02
psoriasis -1.200 3.4e-07
Pick disease -2.500 7.2e-08
progressive supranuclear palsy -2.100 6.5e-03
ovarian cancer -1.900 3.2e-08
pituitary cancer -1.300 8.9e-03
dermatomyositis 1.200 5.0e-04

Gene RIF (1)

PMID Text
23703728 A c.683C>T (p.Thr228Met) mutation in FNBP4 was found as a primary candidate to microphthalmia with limb anomalies

AA Sequence

MGKKSRAVPGRRPILQLSPPGPRGSTPGRDPEPEPDTEPDSTAAVPSQPAPSAATTTTTAVTAAAASDDS      1 - 70
PSEDEQEAVQEVPRVVQNPPKPVMTTRPTAVKATGGLCLLGAYADSDDDDNDVSEKLAQSKETNGNQSTD     71 - 140
IDSTLANFLAEIDAITAPQPAAPVGASAPPPTPPRPEPKEAATSTLSSSTSNGTDSTQTSGWQYDTQCSL    141 - 210
AGVGIEMGDWQEVWDENTGCYYYWNTQTNEVTWELPQYLATQVQGLQHYQPSSVPGAETSFVVNTDIYSK    211 - 280
EKTISVSSSKSGPVIAKREVKKEVNEGIQALSNSEEEKKGVAASLLAPLLPEGIKEEEERWRRKVICKEE    281 - 350
PVSEVKETSTTVEEATTIVKPQEIMLDNIEDPSQEDLCSVVQSGESEEEEEQDTLELELVLERKKAELRA    351 - 420
LEEGDGSVSGSSPRSDISQPASQDGMRRLMSKRGKWKMFVRATSPESTSRSSSKTGRDTPENGETAIGAE    421 - 490
NSEKIDENSDKEMEVEESPEKIKVQTTPKVEEEQDLKFQIGELANTLTSKFEFLGINRQSISNFHVLLLQ    491 - 560
TETRIADWREGALNGNYLKRKLQDAAEQLKQYEINATPKGWSCHWDRDHRRYFYVNEQSGESQWEFPDGE    561 - 630
EEEEESQAQENRDETLAKQTLKDKTGTDSNSTESSETSTGSLCKESFSGQVSSSSLMPLTPFWTLLQSNV    631 - 700
PVLQPPLPLEMPPPPPPPPESPPPPPPPPPPAEDGEIQEVEMEDEGSEEPPAPGTEEDTPLKPSAQTTVV    701 - 770
TSQSSVDSTISSSSSTKGIKRKATEISTAVVQRSATIGSSPVLYSQSAIATGHQAAGIGNQATGIGHQTI    771 - 840
PVSLPAAGMGHQARGMSLQSNYLGLAAAPAIMSYAECSVPIGVTAPSLQPVQARGAVPTATIIEPPPPPP    841 - 910
PPPPPPPPAPKMPPPEKTKKGRKDKAKKSKTKMPSLVKKWQSIQRELDEEDNSSSSEEDRESTAQKRIEE    911 - 980
WKQQQLVSGMAERNANFEALPEDWRARLKRRKMAPNT                                     981 - 1017
//

Text Mined References (31)

PMID Year Title
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
23703728 2013 Whole-exome sequencing identified a homozygous FNBP4 mutation in a family with a condition similar to microphthalmia with limb anomalies.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17500595 2007 Huntingtin interacting proteins are genetic modifiers of neurodegeneration.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15231748 2004 Functional proteomics mapping of a human signaling pathway.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12421765 2002 Protein-protein interactions between large proteins: two-hybrid screening using a functionally classified library composed of long cDNAs.
12168954 2002 Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones.
11292345 2001 Selection of ligands by panning of domain libraries displayed on phage lambda reveals new potential partners of synaptojanin 1.
10748127 2000 Arginine methylation inhibits the binding of proline-rich ligands to Src homology 3, but not WW, domains.
10744724 2000 A novel pro-Arg motif recognized by WW domains.
10231032 1999 Prediction of the coding sequences of unidentified human genes. XIII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
8895530 1996 A pancreatic cancer-specific expression profile.