Property Summary

NCBI Gene PubMed Count 16
PubMed Score 7.10
PubTator Score 11.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6685 2.4e-05
ovarian cancer 8491 3.0e-04
Disease Target Count Z-score Confidence
Type 2 diabetes mellitus 192 0.0 2.0

Expression

  Differential Expression (2)

Disease log2 FC p
psoriasis 2.100 2.4e-05
ovarian cancer 1.200 3.0e-04

Synonym

Accession Q9HA64 Q969F4 Q9H0U7
Symbols FN3KL

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (5)

PMID Text
18637789 Studies provide evidence that Fn3KRP possesses an ATP-binding domain that is structurally related to that of both the aminoglycoside kinases and eukaryotic protein kinases.
17686456 FN3KRP phosphorylates meglumine to produce meglumine-4-phosphate.
16920277 In this paper we propose a resolution of both these quandaries by proposing that fructosamine-6-phosphates are deglycated by phosphorylation to fructosamine-3,6-bisphosphates catalyzed by FN3KRP and/or possibly FN3K.
16037310 Enzyme is a constitutive "housekeeping" gene and that ig plays an important role in cell metabolism, possibly as a deglycating enzyme.
15381090 These data suggest that FN3K and FN3KRP act as protein repair enzymes and are expressed constitutively in human cells independently of some of the variables altered in the diabetic state.

AA Sequence

MEELLRRELGCSSVRATGHSGGGCISQGRSYDTDQGRVFVKVNPKAEARRMFEGEMASLTAILKTNTVKV      1 - 70
PKPIKVLDAPGGGSVLVMEHMDMRHLSSHAAKLGAQLADLHLDNKKLGEMRLKEAGTVGRGGGQEERPFV     71 - 140
ARFGFDVVTCCGYLPQVNDWQEDWVVFYARQRIQPQMDMVEKESGDREALQLWSALQLKIPDLFRDLEII    141 - 210
PALLHGDLWGGNVAEDSSGPVIFDPASFYGHSEYELAIAGMFGGFSSSFYSAYHGKIPKAPGFEKRLQLY    211 - 280
QLFHYLNHWNHFGSGYRGSSLNIMRNLVK                                             281 - 309
//

Text Mined References (18)

PMID Year Title
24647736 2014 Multiple nonglycemic genomic loci are newly associated with blood level of glycated hemoglobin in East Asians.
24244560 2013 A study assessing the association of glycated hemoglobin A1C (HbA1C) associated variants with HbA1C, chronic kidney disease and diabetic retinopathy in populations of Asian ancestry.
21269460 2011 Initial characterization of the human central proteome.
20858683 2010 Common variants at 10 genomic loci influence hemoglobin A?(C) levels via glycemic and nonglycemic pathways.
19369195 2009 Large-scale proteomics analysis of the human kinome.
18637789 2008 Mapping of the ATP-binding domain of human fructosamine 3-kinase-related protein by affinity labelling with 5'-[p-(fluorosulfonyl)benzoyl]adenosine.
17686456 2007 Fructosamine-3-kinase-related-protein phosphorylates glucitolamines on the C-4 hydroxyl: novel substrate specificity of an enigmatic enzyme.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16920277 2007 Fructosamine-6-phosphates are deglycated by phosphorylation to fructosamine-3,6-bisphosphates catalyzed by fructosamine-3-kinase (FN3K) and/or fructosamine-3-kinase-related-protein (FN3KRP).
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16037310 2005 Some clues as to the regulation, expression, function, and distribution of fructosamine-3-kinase and fructosamine-3-kinase-related protein.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15381090 2004 The expression of the genes for fructosamine-3-kinase and fructosamine-3-kinase-related protein appears to be constitutive and unaffected by environmental signals.
15137908 2004 Fructosamine 3-kinase-related protein and deglycation in human erythrocytes.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14633848 2003 A mammalian protein homologous to fructosamine-3-kinase is a ketosamine-3-kinase acting on psicosamines and ribulosamines but not on fructosamines.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.