Property Summary

NCBI Gene PubMed Count 24
PubMed Score 28.56
PubTator Score 37.24

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6685 9.9e-55
osteosarcoma 7933 6.8e-04

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.005 6.8e-04
psoriasis -1.200 9.9e-55

Synonym

Accession Q9H479
Symbols

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (14)

PMID Text
26352355 FN3K could act in concert with other molecular mechanisms and may impact on gene expression and activity of other enzymes involved in deglycation process
24908234 Report association of rs1056534 and rs3848403 of fructosamine 3-kinase gene with sRAGE in patients with diabetes.
23492569 The marginal association of rs1056534 of FN3K is located in exon 6 with diabetic nephropathy progression.
21288167 two new mutations and additional variants within the FN3K gene in diabetic patients
21253391 These findings suggest that deglycating enzymes Glyoxalase I and fructosamine-3-kinase may be involved in the malignant transformation of colon mucosa.
20858683 Observational study, meta-analysis, and genome-wide association study of gene-disease association. (HuGE Navigator)
19834870 G900C polymorphism associates with the level of HbA (1c) and the onset of type 2 diabetes mellitus, but not with either of the diabetic microvascular complications.
19834870 Observational study of gene-disease association. (HuGE Navigator)
16920277 In this paper we propose a resolution of both these quandaries by proposing that fructosamine-6-phosphates are deglycated by phosphorylation to fructosamine-3,6-bisphosphates catalyzed by FN3KRP and/or possibly FN3K.
16523184 No significant correlation between FN3K activity and the levels of HbA1c, total glycated haemoglobin (GHb) and haemoglobin fructoselysine residues, either in the normoglycaemic or diabetic group.
16037310 Enzyme is a constitutive "housekeeping" gene and that ig plays an important role in cell metabolism, possibly as a deglycating enzyme.
15381090 These data suggest that FN3K and FN3KRP act as protein repair enzymes and are expressed constitutively in human cells independently of some of the variables altered in the diabetic state.
15102834 The aim of this work was to identify the fructosamine residues on hemoglobin that are removed as a result of the action of FN3K in intact erythrocytes.
11975663 involved in the removal of fructosamine residues from hemoglobin in erythrocytes.

AA Sequence

MEQLLRAELRTATLRAFGGPGAGCISEGRAYDTDAGPVFVKVNRRTQARQMFEGEVASLEALRSTGLVRV      1 - 70
PRPMKVIDLPGGGAAFVMEHLKMKSLSSQASKLGEQMADLHLYNQKLREKLKEEENTVGRRGEGAEPQYV     71 - 140
DKFGFHTVTCCGFIPQVNEWQDDWPTFFARHRLQAQLDLIEKDYADREARELWSRLQVKIPDLFCGLEIV    141 - 210
PALLHGDLWSGNVAEDDVGPIIYDPASFYGHSEFELAIALMFGGFPRSFFTAYHRKIPKAPGFDQRLLLY    211 - 280
QLFNYLNHWNHFGREYRSPSLGTMRRLLK                                             281 - 309
//

Text Mined References (25)

PMID Year Title
26352355 2015 Possible role of fructosamine 3-kinase genotyping for the management of diabetic patients.
24908234 2014 Fructosamine 3-kinase and glyoxalase I polymorphisms and their association with soluble RAGE and adhesion molecules in diabetes.
24647736 2014 Multiple nonglycemic genomic loci are newly associated with blood level of glycated hemoglobin in East Asians.
24244560 2013 A study assessing the association of glycated hemoglobin A1C (HbA1C) associated variants with HbA1C, chronic kidney disease and diabetic retinopathy in populations of Asian ancestry.
23492569 2014 Genetic variability in enzymes of metabolic pathways conferring protection against non-enzymatic glycation versus diabetes-related morbidity and mortality.
21924559 2011 The physiological substrates of fructosamine-3-kinase-related-protein (FN3KRP) are intermediates of nonenzymatic reactions between biological amines and ketose sugars (fructation products).
21492153 2011 Analysis of proteomic changes induced upon cellular differentiation of the human intestinal cell line Caco-2.
21288167 2011 Genetic variability of the fructosamine 3-kinase gene in diabetic patients.
21269460 2011 Initial characterization of the human central proteome.
21253391 2011 Low red blood cell levels of deglycating enzymes in colorectal cancer patients.
20858683 2010 Common variants at 10 genomic loci influence hemoglobin A?(C) levels via glycemic and nonglycemic pathways.
19834870 2010 A polymorphism within the fructosamine-3-kinase gene is associated with HbA1c Levels and the onset of type 2 diabetes mellitus.
16920277 2007 Fructosamine-6-phosphates are deglycated by phosphorylation to fructosamine-3,6-bisphosphates catalyzed by fructosamine-3-kinase (FN3K) and/or fructosamine-3-kinase-related-protein (FN3KRP).
16523184 2006 Variability in erythrocyte fructosamine 3-kinase activity in humans correlates with polymorphisms in the FN3K gene and impacts on haemoglobin glycation at specific sites.
16037310 2005 Some clues as to the regulation, expression, function, and distribution of fructosamine-3-kinase and fructosamine-3-kinase-related protein.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15381090 2004 The expression of the genes for fructosamine-3-kinase and fructosamine-3-kinase-related protein appears to be constitutive and unaffected by environmental signals.
15331600 2004 Tissue distribution and evolution of fructosamine 3-kinase and fructosamine 3-kinase-related protein.
15102834 2004 Identification of fructosamine residues deglycated by fructosamine-3-kinase in human hemoglobin.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14641062 2003 Fructosamine 3-kinase, an enzyme involved in protein deglycation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11975663 2002 Fructosamine 3-kinase is involved in an intracellular deglycation pathway in human erythrocytes.
11522682 2001 Human fructosamine-3-kinase: purification, sequencing, substrate specificity, and evidence of activity in vivo.
11016445 2000 Identification, cloning, and heterologous expression of a mammalian fructosamine-3-kinase.