Property Summary

Ligand Count 4
NCBI Gene PubMed Count 593
PubMed Score 1208.78
PubTator Score 768.34

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Kidney cancer 2613 0.0 1.0
Disease Target Count Z-score Confidence
Cardiovascular system disease 246 0.0 0.9
Disease Target Count Z-score Confidence
Cancer 2499 4.725 2.4
Kidney disease 430 3.158 1.6
Osteomalacia 35 3.114 1.6

Expression

  Differential Expression (38)

Disease log2 FC p
glioblastoma 1.800 8.7e-09
malignant mesothelioma -1.100 1.6e-06
adrenocortical carcinoma 1.587 1.5e-03
adult high grade glioma 1.500 1.7e-04
astrocytic glioma 1.200 3.8e-02
Astrocytoma, Pilocytic 1.200 4.3e-04
Atopic dermatitis -1.100 2.5e-02
atypical teratoid / rhabdoid tumor 1.200 1.7e-03
Becker muscular dystrophy 1.107 2.5e-02
Breast cancer 4.800 3.0e-02
breast carcinoma 2.000 5.4e-23
cystic fibrosis 1.700 2.4e-04
Duchenne muscular dystrophy 1.391 9.9e-06
ductal carcinoma in situ 1.600 1.3e-02
ependymoma 1.600 2.6e-02
gastric carcinoma 1.900 4.0e-02
Gaucher disease type 1 -2.500 1.6e-02
Hydrolethalus syndrome 1.324 2.8e-02
interstitial lung disease 1.900 3.8e-03
invasive ductal carcinoma 2.149 6.7e-04
juvenile dermatomyositis 1.489 5.2e-09
limb girdle muscular dystrophy 2A 1.261 1.1e-03
lung carcinoma -1.500 1.6e-12
medulloblastoma, large-cell 1.800 1.4e-03
nasopharyngeal carcinoma 2.700 1.9e-06
nephrosclerosis 1.380 1.0e-03
oligodendroglioma 1.200 3.7e-02
osteosarcoma 1.807 3.9e-03
ovarian cancer -2.700 1.1e-03
pancreatic cancer 1.600 6.6e-04
Polycystic ovary syndrome -2.508 3.3e-02
primary pancreatic ductal adenocarcinoma 3.810 4.3e-05
primitive neuroectodermal tumor 1.100 2.3e-02
pterygium 2.300 1.4e-02
sonic hedgehog group medulloblastoma 1.300 1.3e-04
tuberculosis and treatment for 3 months -1.700 1.1e-04
ulcerative colitis 1.500 3.1e-02
urothelial carcinoma 2.500 3.5e-03

PDB (53)

Gene RIF (414)

AA Sequence

MLRGPGPGLLLLAVQCLGTAVPSTGASKSKRQAQQMVQPQSPVAVSQSKPGCYDNGKHYQINQQWERTYL      1 - 70
GNALVCTCYGGSRGFNCESKPEAEETCFDKYTGNTYRVGDTYERPKDSMIWDCTCIGAGRGRISCTIANR     71 - 140
CHEGGQSYKIGDTWRRPHETGGYMLECVCLGNGKGEWTCKPIAEKCFDHAAGTSYVVGETWEKPYQGWMM    141 - 210
VDCTCLGEGSGRITCTSRNRCNDQDTRTSYRIGDTWSKKDNRGNLLQCICTGNGRGEWKCERHTSVQTTS    211 - 280
SGSGPFTDVRAAVYQPQPHPQPPPYGHCVTDSGVVYSVGMQWLKTQGNKQMLCTCLGNGVSCQETAVTQT    281 - 350
YGGNSNGEPCVLPFTYNGRTFYSCTTEGRQDGHLWCSTTSNYEQDQKYSFCTDHTVLVQTRGGNSNGALC    351 - 420
HFPFLYNNHNYTDCTSEGRRDNMKWCGTTQNYDADQKFGFCPMAAHEEICTTNEGVMYRIGDQWDKQHDM    421 - 490
GHMMRCTCVGNGRGEWTCIAYSQLRDQCIVDDITYNVNDTFHKRHEEGHMLNCTCFGQGRGRWKCDPVDQ    491 - 560
CQDSETGTFYQIGDSWEKYVHGVRYQCYCYGRGIGEWHCQPLQTYPSSSGPVEVFITETPSQPNSHPIQW    561 - 630
NAPQPSHISKYILRWRPKNSVGRWKEATIPGHLNSYTIKGLKPGVVYEGQLISIQQYGHQEVTRFDFTTT    631 - 700
STSTPVTSNTVTGETTPFSPLVATSESVTEITASSFVVSWVSASDTVSGFRVEYELSEEGDEPQYLDLPS    701 - 770
TATSVNIPDLLPGRKYIVNVYQISEDGEQSLILSTSQTTAPDAPPDTTVDQVDDTSIVVRWSRPQAPITG    771 - 840
YRIVYSPSVEGSSTELNLPETANSVTLSDLQPGVQYNITIYAVEENQESTPVVIQQETTGTPRSDTVPSP    841 - 910
RDLQFVEVTDVKVTIMWTPPESAVTGYRVDVIPVNLPGEHGQRLPISRNTFAEVTGLSPGVTYYFKVFAV    911 - 980
SHGRESKPLTAQQTTKLDAPTNLQFVNETDSTVLVRWTPPRAQITGYRLTVGLTRRGQPRQYNVGPSVSK    981 - 1050
YPLRNLQPASEYTVSLVAIKGNQESPKATGVFTTLQPGSSIPPYNTEVTETTIVITWTPAPRIGFKLGVR   1051 - 1120
PSQGGEAPREVTSDSGSIVVSGLTPGVEYVYTIQVLRDGQERDAPIVNKVVTPLSPPTNLHLEANPDTGV   1121 - 1190
LTVSWERSTTPDITGYRITTTPTNGQQGNSLEEVVHADQSSCTFDNLSPGLEYNVSVYTVKDDKESVPIS   1191 - 1260
DTIIPAVPPPTDLRFTNIGPDTMRVTWAPPPSIDLTNFLVRYSPVKNEEDVAELSISPSDNAVVLTNLLP   1261 - 1330
GTEYVVSVSSVYEQHESTPLRGRQKTGLDSPTGIDFSDITANSFTVHWIAPRATITGYRIRHHPEHFSGR   1331 - 1400
PREDRVPHSRNSITLTNLTPGTEYVVSIVALNGREESPLLIGQQSTVSDVPRDLEVVAATPTSLLISWDA   1401 - 1470
PAVTVRYYRITYGETGGNSPVQEFTVPGSKSTATISGLKPGVDYTITVYAVTGRGDSPASSKPISINYRT   1471 - 1540
EIDKPSQMQVTDVQDNSISVKWLPSSSPVTGYRVTTTPKNGPGPTKTKTAGPDQTEMTIEGLQPTVEYVV   1541 - 1610
SVYAQNPSGESQPLVQTAVTNIDRPKGLAFTDVDVDSIKIAWESPQGQVSRYRVTYSSPEDGIHELFPAP   1611 - 1680
DGEEDTAELQGLRPGSEYTVSVVALHDDMESQPLIGTQSTAIPAPTDLKFTQVTPTSLSAQWTPPNVQLT   1681 - 1750
GYRVRVTPKEKTGPMKEINLAPDSSSVVVSGLMVATKYEVSVYALKDTLTSRPAQGVVTTLENVSPPRRA   1751 - 1820
RVTDATETTITISWRTKTETITGFQVDAVPANGQTPIQRTIKPDVRSYTITGLQPGTDYKIYLYTLNDNA   1821 - 1890
RSSPVVIDASTAIDAPSNLRFLATTPNSLLVSWQPPRARITGYIIKYEKPGSPPREVVPRPRPGVTEATI   1891 - 1960
TGLEPGTEYTIYVIALKNNQKSEPLIGRKKTDELPQLVTLPHPNLHGPEILDVPSTVQKTPFVTHPGYDT   1961 - 2030
GNGIQLPGTSGQQPSVGQQMIFEEHGFRRTTPPTTATPIRHRPRPYPPNVGEEIQIGHIPREDVDYHLYP   2031 - 2100
HGPGLNPNASTGQEALSQTTISWAPFQDTSEYIISCHPVGTDEEPLQFRVPGTSTSATLTGLTRGATYNV   2101 - 2170
IVEALKDQQRHKVREEVVTVGNSVNEGLNQPTDDSCFDPYTVSHYAVGDEWERMSESGFKLLCQCLGFGS   2171 - 2240
GHFRCDSSRWCHDNGVNYKIGEKWDRQGENGQMMSCTCLGNGKGEFKCDPHEATCYDDGKTYHVGEQWQK   2241 - 2310
EYLGAICSCTCFGGQRGWRCDNCRRPGGEPSPEGTTGQSYNQYSQRYHQRTNTNVNCPIECFMPLDVQAD   2311 - 2380
REDSRE                                                                   2381 - 2386
//

Text Mined References (616)

PMID Year Title