Property Summary

Ligand Count 4
NCBI Gene PubMed Count 593
PubMed Score 1208.78
PubTator Score 768.34

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Kidney cancer 2613 0.0 1.0
Disease Target Count Z-score Confidence
Cardiovascular system disease 246 0.0 0.9
Disease Target Count Z-score Confidence
Cancer 2499 4.725 2.4
Kidney disease 430 3.158 1.6
Osteomalacia 35 3.114 1.6

Expression

  Differential Expression (38)

Disease log2 FC p
glioblastoma 1.800 8.7e-09
malignant mesothelioma -1.100 1.6e-06
adrenocortical carcinoma 1.587 1.5e-03
adult high grade glioma 1.500 1.7e-04
astrocytic glioma 1.200 3.8e-02
Astrocytoma, Pilocytic 1.200 4.3e-04
Atopic dermatitis -1.100 2.5e-02
atypical teratoid / rhabdoid tumor 1.200 1.7e-03
Becker muscular dystrophy 1.107 2.5e-02
Breast cancer 4.800 3.0e-02
breast carcinoma 2.000 5.4e-23
cystic fibrosis 1.700 2.4e-04
Duchenne muscular dystrophy 1.391 9.9e-06
ductal carcinoma in situ 1.600 1.3e-02
ependymoma 1.600 2.6e-02
gastric carcinoma 1.900 4.0e-02
Gaucher disease type 1 -2.500 1.6e-02
Hydrolethalus syndrome 1.324 2.8e-02
interstitial lung disease 1.900 3.8e-03
invasive ductal carcinoma 2.149 6.7e-04
juvenile dermatomyositis 1.489 5.2e-09
limb girdle muscular dystrophy 2A 1.261 1.1e-03
lung carcinoma -1.500 1.6e-12
medulloblastoma, large-cell 1.800 1.4e-03
nasopharyngeal carcinoma 2.700 1.9e-06
nephrosclerosis 1.380 1.0e-03
oligodendroglioma 1.200 3.7e-02
osteosarcoma 1.807 3.9e-03
ovarian cancer -2.700 1.1e-03
pancreatic cancer 1.600 6.6e-04
Polycystic ovary syndrome -2.508 3.3e-02
primary pancreatic ductal adenocarcinoma 3.810 4.3e-05
primitive neuroectodermal tumor 1.100 2.3e-02
pterygium 2.300 1.4e-02
sonic hedgehog group medulloblastoma 1.300 1.3e-04
tuberculosis and treatment for 3 months -1.700 1.1e-04
ulcerative colitis 1.500 3.1e-02
urothelial carcinoma 2.500 3.5e-03

Gene

FN1

PANTHER Protein Class (1)

PDB

2OCF   3EJH   3GXE   1E88   1E8B   1FBR   1FNA   1FNF   1FNH   1J8K   1O9A   1OWW   1Q38   1QGB   1QO6   1TTF   1TTG   2CG6   2CG7   2CK2   2CKU   2EC3   2FN2   2FNB   2GEE   2H41   2H45   2HA1   2MNU   2N1K   2RKY   2RKZ   2RL0   3CAL   3M7P   3MQL   3R8Q   3T1W   3ZRZ   4GH7   4JE4   4JEG   4LXO   4MMX   4MMY   4MMZ   4PZ5   5DC0   5DC4   5DC9   5DFT   5J6Z   5J7C  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (414)

AA Sequence

MLRGPGPGLLLLAVQCLGTAVPSTGASKSKRQAQQMVQPQSPVAVSQSKPGCYDNGKHYQINQQWERTYL      1 - 70
GNALVCTCYGGSRGFNCESKPEAEETCFDKYTGNTYRVGDTYERPKDSMIWDCTCIGAGRGRISCTIANR     71 - 140
CHEGGQSYKIGDTWRRPHETGGYMLECVCLGNGKGEWTCKPIAEKCFDHAAGTSYVVGETWEKPYQGWMM    141 - 210
VDCTCLGEGSGRITCTSRNRCNDQDTRTSYRIGDTWSKKDNRGNLLQCICTGNGRGEWKCERHTSVQTTS    211 - 280
SGSGPFTDVRAAVYQPQPHPQPPPYGHCVTDSGVVYSVGMQWLKTQGNKQMLCTCLGNGVSCQETAVTQT    281 - 350
YGGNSNGEPCVLPFTYNGRTFYSCTTEGRQDGHLWCSTTSNYEQDQKYSFCTDHTVLVQTRGGNSNGALC    351 - 420
HFPFLYNNHNYTDCTSEGRRDNMKWCGTTQNYDADQKFGFCPMAAHEEICTTNEGVMYRIGDQWDKQHDM    421 - 490
GHMMRCTCVGNGRGEWTCIAYSQLRDQCIVDDITYNVNDTFHKRHEEGHMLNCTCFGQGRGRWKCDPVDQ    491 - 560
CQDSETGTFYQIGDSWEKYVHGVRYQCYCYGRGIGEWHCQPLQTYPSSSGPVEVFITETPSQPNSHPIQW    561 - 630
NAPQPSHISKYILRWRPKNSVGRWKEATIPGHLNSYTIKGLKPGVVYEGQLISIQQYGHQEVTRFDFTTT    631 - 700
STSTPVTSNTVTGETTPFSPLVATSESVTEITASSFVVSWVSASDTVSGFRVEYELSEEGDEPQYLDLPS    701 - 770
TATSVNIPDLLPGRKYIVNVYQISEDGEQSLILSTSQTTAPDAPPDTTVDQVDDTSIVVRWSRPQAPITG    771 - 840
YRIVYSPSVEGSSTELNLPETANSVTLSDLQPGVQYNITIYAVEENQESTPVVIQQETTGTPRSDTVPSP    841 - 910
RDLQFVEVTDVKVTIMWTPPESAVTGYRVDVIPVNLPGEHGQRLPISRNTFAEVTGLSPGVTYYFKVFAV    911 - 980
SHGRESKPLTAQQTTKLDAPTNLQFVNETDSTVLVRWTPPRAQITGYRLTVGLTRRGQPRQYNVGPSVSK    981 - 1050
YPLRNLQPASEYTVSLVAIKGNQESPKATGVFTTLQPGSSIPPYNTEVTETTIVITWTPAPRIGFKLGVR   1051 - 1120
PSQGGEAPREVTSDSGSIVVSGLTPGVEYVYTIQVLRDGQERDAPIVNKVVTPLSPPTNLHLEANPDTGV   1121 - 1190
LTVSWERSTTPDITGYRITTTPTNGQQGNSLEEVVHADQSSCTFDNLSPGLEYNVSVYTVKDDKESVPIS   1191 - 1260
DTIIPAVPPPTDLRFTNIGPDTMRVTWAPPPSIDLTNFLVRYSPVKNEEDVAELSISPSDNAVVLTNLLP   1261 - 1330
GTEYVVSVSSVYEQHESTPLRGRQKTGLDSPTGIDFSDITANSFTVHWIAPRATITGYRIRHHPEHFSGR   1331 - 1400
PREDRVPHSRNSITLTNLTPGTEYVVSIVALNGREESPLLIGQQSTVSDVPRDLEVVAATPTSLLISWDA   1401 - 1470
PAVTVRYYRITYGETGGNSPVQEFTVPGSKSTATISGLKPGVDYTITVYAVTGRGDSPASSKPISINYRT   1471 - 1540
EIDKPSQMQVTDVQDNSISVKWLPSSSPVTGYRVTTTPKNGPGPTKTKTAGPDQTEMTIEGLQPTVEYVV   1541 - 1610
SVYAQNPSGESQPLVQTAVTNIDRPKGLAFTDVDVDSIKIAWESPQGQVSRYRVTYSSPEDGIHELFPAP   1611 - 1680
DGEEDTAELQGLRPGSEYTVSVVALHDDMESQPLIGTQSTAIPAPTDLKFTQVTPTSLSAQWTPPNVQLT   1681 - 1750
GYRVRVTPKEKTGPMKEINLAPDSSSVVVSGLMVATKYEVSVYALKDTLTSRPAQGVVTTLENVSPPRRA   1751 - 1820
RVTDATETTITISWRTKTETITGFQVDAVPANGQTPIQRTIKPDVRSYTITGLQPGTDYKIYLYTLNDNA   1821 - 1890
RSSPVVIDASTAIDAPSNLRFLATTPNSLLVSWQPPRARITGYIIKYEKPGSPPREVVPRPRPGVTEATI   1891 - 1960
TGLEPGTEYTIYVIALKNNQKSEPLIGRKKTDELPQLVTLPHPNLHGPEILDVPSTVQKTPFVTHPGYDT   1961 - 2030
GNGIQLPGTSGQQPSVGQQMIFEEHGFRRTTPPTTATPIRHRPRPYPPNVGEEIQIGHIPREDVDYHLYP   2031 - 2100
HGPGLNPNASTGQEALSQTTISWAPFQDTSEYIISCHPVGTDEEPLQFRVPGTSTSATLTGLTRGATYNV   2101 - 2170
IVEALKDQQRHKVREEVVTVGNSVNEGLNQPTDDSCFDPYTVSHYAVGDEWERMSESGFKLLCQCLGFGS   2171 - 2240
GHFRCDSSRWCHDNGVNYKIGEKWDRQGENGQMMSCTCLGNGKGEFKCDPHEATCYDDGKTYHVGEQWQK   2241 - 2310
EYLGAICSCTCFGGQRGWRCDNCRRPGGEPSPEGTTGQSYNQYSQRYHQRTNTNVNCPIECFMPLDVQAD   2311 - 2380
REDSRE                                                                   2381 - 2386
//

Text Mined References (616)

PMID Year Title