Property Summary

NCBI Gene PubMed Count 10
PubMed Score 5.18
PubTator Score 3.65

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 0.9

Expression

Gene RIF (3)

AA Sequence

MSSHRRKAKGRNRRSHRAMRVAHLELATYELAATESNPESSHPGYEAAMADRPQPGWRESLKMRVSKPFG      1 - 70
MLMLSIWILLFVCYYLSYYLCSGSSYFVLANGHILPNSENAHGQSLEEDSALEALLNFFFPTTCNLRENQ     71 - 140
VAKPCNELQDLSESECLRHKCCFSSSGTTSFKCFAPFRDVPKQMMQMFGLGAISLILVCLPIYCRSLFWR    141 - 210
SEPADDLQRQDNRVVTGLKKQRRKRKRKSEMLQKAARGREEHGDE                             211 - 255
//

Text Mined References (10)

PMID Year Title