Property Summary

NCBI Gene PubMed Count 21
PubMed Score 9.11
PubTator Score 24.47

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
interstitial lung disease -1.600 2.9e-02
esophageal adenocarcinoma 1.500 3.6e-02
psoriasis -1.100 2.2e-05
cutaneous lupus erythematosus -1.400 3.3e-03
ulcerative colitis -2.100 4.3e-06
pancreatic ductal adenocarcinoma liver m... -1.997 6.1e-04
tuberculosis 1.200 6.7e-05
non-small cell lung cancer -1.820 2.1e-10
intraductal papillary-mucinous adenoma (... 3.300 7.8e-06
intraductal papillary-mucinous carcinoma... 1.700 1.8e-03
intraductal papillary-mucinous neoplasm ... 1.300 2.0e-02
lung cancer -4.700 1.7e-06
colon cancer -2.400 1.1e-03
interstitial cystitis -2.000 2.7e-05
pilocytic astrocytoma 1.100 1.5e-03
lung adenocarcinoma 1.474 1.5e-02
nasopharyngeal carcinoma -1.100 2.6e-07
lung carcinoma -1.200 4.2e-04
Breast cancer -2.000 1.7e-05
pituitary cancer -1.200 7.7e-03

 GO Process (1)

 GWAS Trait (1)

Protein-protein Interaction (5)

Gene RIF (4)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19898482 Observational study of gene-disease association. (HuGE Navigator)
19834535 Observational study of gene-disease association. (HuGE Navigator)
16183778 fmo5 displayed a significant, dominant liver-specific mRNA profile.

AA Sequence

MTKKRIAVIGGGVSGLSSIKCCVEEGLEPVCFERTDDIGGLWRFQENPEEGRASIYKSVIINTSKEMMCF      1 - 70
SDYPIPDHYPNFMHNAQVLEYFRMYAKEFDLLKYIRFKTTVCSVKKQPDFATSGQWEVVTESEGKKEMNV     71 - 140
FDGVMVCTGHHTNAHLPLESFPGIEKFKGQYFHSRDYKNPEGFTGKRVIIIGIGNSGGDLAVEISQTAKQ    141 - 210
VFLSTRRGAWILNRVGDYGYPADVLFSSRLTHFIWKICGQSLANKYLEKKINQRFDHEMFGLKPKHRALS    211 - 280
QHPTLNDDLPNRIISGLVKVKGNVKEFTETAAIFEDGSREDDIDAVIFATGYSFDFPFLEDSVKVVKNKI    281 - 350
SLYKKVFPPNLERPTLAIIGLIQPLGAIMPISELQGRWATQVFKGLKTLPSQSEMMAEISKAQEEIDKRY    351 - 420
VESQRHTIQGDYIDTMEELADLVGVRPNLLSLAFTDPKLALHLLLGPCTPIHYRVQGPGKWDGARKAILT    421 - 490
TDDRIRKPLMTRVVERSSSMTSTMTIGKFMLALAFFAIIIAYF                               491 - 533
//

Text Mined References (23)

PMID Year Title
25240745 2014 A genome-wide association study in the genetic analysis of idiopathic thrombophilia project suggests sex-specific regulation of mitochondrial DNA levels.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19898482 2009 Genetic variants in TPMT and COMT are associated with hearing loss in children receiving cisplatin chemotherapy.
19834535 2009 Sequential use of transcriptional profiling, expression quantitative trait mapping, and gene association implicates MMP20 in human kidney aging.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16183778 2006 Quantitative analysis of FMO gene mRNA levels in human tissues.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12527699 2003 Identification of novel variants of the flavin-containing monooxygenase gene family in African Americans.
12490590 2003 Human kidney flavin-containing monooxygenases and their potential roles in cysteine s-conjugate metabolism and nephrotoxicity.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11551524 2001 Quantification and cellular localization of expression in human skin of genes encoding flavin-containing monooxygenases and cytochromes P450.
11128045 2000 Oxidation of ranitidine by isozymes of flavin-containing monooxygenase and cytochrome P450.
9305407 1997 Quantitation and kinetic properties of hepatic microsomal and recombinant flavin-containing monooxygenases 3 and 5 from humans.
9119381 1997 Physical mapping of the human connexin 40 (GJA5), flavin-containing monooxygenase 5, and natriuretic peptide receptor a genes on 1q21.
8786146 1996 Localization of human flavin-containing monooxygenase genes FMO2 and FMO5 to chromosome 1q.
8311461 1994 A nomenclature for the mammalian flavin-containing monooxygenase gene family based on amino acid sequence identities.
8128486 1994 The mammalian flavin-containing monooxygenases: molecular characterization and regulation of expression.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7872795 1995 Characterization of flavin-containing monooxygenase 5 (FMO5) cloned from human and guinea pig: evidence that the unique catalytic properties of FMO5 are not confined to the rabbit ortholog.
7720101 1995 The molecular biology of the flavin-containing monooxygenases of man.