Property Summary

NCBI Gene PubMed Count 97
PubMed Score 219.15
PubTator Score 216.61

Knowledge Summary

Patent

No data available

Expression

 GWAS Trait (1)

Protein-protein Interaction (1)

Gene RIF (71)

PMID Text
26616280 Oxidative stress-responsive transcription factor NRF2 is not indispensable for the human hepatic Flavin-containing monooxygenase-3 (FMO3) gene expression in HepG2 cells
26519273 FMO3 gene polymorphism E158K is a significant predictor of predisposition to chronic heart disease in women.
26218418 FMO3 is centrally involved in the pathogenesis of atherosclerosis by regulating cholesterol metabolism and insulin resistance. [Review]
25849138 FMO3 expression is increased in obese/insulin resistant patients.
25760532 These results suggest that genetic polymorphism in the human FMO3 gene may lead to changes of drug interactions for N- or S-oxygenations of xenobiotics and endogenous substances.
25288227 Three polymorphisms were found in intronic regions of FMO3 in a child with trimethylaminuria and in her parents and a brother. The parents and brother showed no symptoms.
25224784 Effect of two-linked mutations of the FMO3 gene on itopride metabolism in Chinese healthy volunteers
24448396 results show that FMO3 E158K and POR A503V polymorphisms are minor sources of nicotine metabolism variation, insufficient to appreciably alter smoking.
24173915 FMO3 (rs2266780) was in complete linkage disequilibrium with FMO6.
24028545 Comparisons of genotype and phenotype reveal that severe trimethylaminuria is caused by loss of function mutations in FMO3
23855261 CYP3A4 and FMO3 are the major enzymes responsible for the metabolism of teneligliptin in humans.
23791655 Novel variations in the FMO3 gene associated with trimethylaminuria.
23567996 provides fundamental, up-to-date information on the importance of human FMO3 in individual xenobiotic oxygenations, including those of new medicines and dietary-derived trimethylamine
23510775 FMO3 heterozygote genotypes increase the risk of stroke 6 times in hypertensives in Turkish population.
23350966 single-nucleotide polymorphisms in the FMO3 gene is associated with chronic allograft dysfunction.
23266626 Genetic variations in the FMO3 gene in patients with trimethylaminuria do not always present with fish-like body odor.
23211429 Polymorphisms in FMO3 influence nicotine clearance and that these genetic variants in turn influence cigarette consumption.
23147717 data support the role of FMO3 in the N-oxidation of OLA and implicate for the first time the contribution of FMO1 and its functional *6 variant in OLA disposition
22819296 Six novel variants of the FMO3 gene have been found responsible for trimethylaminuria in a Japanese population.
22409263 It was found that FMO3 158K, 257M and 308G alleles, demonstrate impaired metabolism toward many FMO3 substrates, were observed frequently in Turkish population similar to the other populations
21075259 patient heterozygous for 4 FMO3 mutations
20734064 Observational study of gene-disease association. (HuGE Navigator)
20679960 Observational study of gene-disease association. (HuGE Navigator)
20529763 Observational study of gene-disease association. (HuGE Navigator)
20198379 This study is the first to demonstrate a gene-environment interaction in SIDS. The findings suggest that the common polymorphism G472A of FMO3 could act as an additional genetic SIDS risk factor in children whose mothers smoke.
20198379 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20182906 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20173083 Observational study of genotype prevalence. (HuGE Navigator)
20056567 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19898482 Observational study of gene-disease association. (HuGE Navigator)
19761368 Distribution of functionally relevant FMO3 polymorphisms varies not only between ethnicities but also within
19761368 Observational study of genotype prevalence. (HuGE Navigator)
19577495 The identification in a family from northern Norway of a novel causative mutation of FMO3 gene causing trimethylaminuria, is described.
19571433 considerable individual differences in FMO3 levels may exist in Japanese livers. The liver-enriched transcription factor HNF-4 appears to be a determinant of FMO3 expression in livers, as well as the ubiquitous factor NF-Y.
19356079 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19336370 Observational study of gene-disease association. (HuGE Navigator)
19321370 the combination of V187A/E158K mutations in FMO3, the enzyme activity is severely affected and possibly contributes to the trimethylaminuria observed.
18443301 Localization of mutations in human FMO3 that are known to cause trimethylaminuria (fish-odor syndrome) in the elucidated FMO structure provides a structural explanation for their biological effects.
18305374 Site-directed mutagenesis studies suggest that the putative hepatic nuclear factor-4 (HNF-4) binding site and CCAAT box could be responsible cis-acting elements of the FMO3 gene in a Japanese population.
18180394 Observational study of gene-disease association. (HuGE Navigator)
18051367 HIV-1 Tat upregulates flavin containing monooxygenase 3 (FMO3) in HEK 293T cells
17885620 The results provide evidence that FMO3 has been the subject of balancing selection.
17881660 TG100435 and TG100855 were interconverted metabolically. FMO3 seem to be the major N-oxidizing enzyme, whereas cytochrome P450 reductase seems to be responsible for the retroreduction reaction.
17786630 FMO3 is the primary human adult liver FMO enzyme, but is developmentally regulated
17584019 Observational study of genotype prevalence. (HuGE Navigator)
17584019 Mutations of the FMO3 gene were investigated in Japanese trimethylaminuria that showed low FMO3 metabolic capacity.
17559352 This review summarizes the current state of research on the genetic polymorphisms of FMO3, with a focus on their clinical implications in gastrointestinal diseases.
17531949 A homology model for FMO3 was constructed based on the crystal structure for yeast FMO which places the N61 residue alone, of the mutants analyzed here, in close proximity to the FAD catalytic center.
17257434 abnormal FMO3 capacity is caused by menstruation particularly in the presence, in homozygous form, of mild genetic variants such as [Glu158Lys; Glu308Gly] that cause a reduced FMO3 function
17142560 results suggest that the effects of genetic variation of FMO3 could operate at the functional level for N- & S-oxygenation for typical FMO3 substrates
17096187 Observational study of genotype prevalence. (HuGE Navigator)
16996766 Individuals homozygous for either of the nonsense mutations--Arg500Stop and/or Cys197Stop--alleles in the FMO3 gene can possess abnormal trimethylamine N-oxygenation.
16863467 As summarized in this review, FMO3 is apparently unique to the human, yet is the most abundant FMO family member in the adult human liver, whereas FMO1 dominates in most animal models.
16858129 The study is said to be the first report for significant single nucleotide polymorphisms of the FMO3 causing amino acid substitutions in Japanese trimethylaminuria patients.
16800822 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16800822 The genotypes and allele frequencies of the MDR1/C3435T, FMO3/G488A, FMO3/A923G and CYP1A2/G-3860 A polymorphisms were not significantly different in cancer-free subjects and CRC patients.
16600650 Genetic basis of trimethylaminuria is studied in Italian pedigrees and shows a spectrum of variation in the FM03 gene with 3 novel mutations: a de novo missense mutation, a deletion (G1182del) at codon 394 and a novel missense mutation (R238P).
16598836 Observational study of genotype prevalence. (HuGE Navigator)
16481213 Flavin-containing monooxygenase 3 (FMO3) is responsible for the majority of FMO-mediated xenobiotic metabolism in the adult human liver.
16324215 Observational study of gene-disease association. (HuGE Navigator)
16324215 variants in the FMO3 gene do not predispose to essential hypertension in a cardiovascular disease population of 1649 individuals, 691(41.9%) of whom had a history of hypertension requiring drug treatment
16214918 Observational study of gene-disease association. (HuGE Navigator)
16183778 FMO3 displayed a significant, dominant liver-specific mRNA profile.
15623613 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15203093 "..FMO3 appears to be the most important flavin-containing monoxygenase..in adult human liver. p. 574 "..human FMO3 appears to oxygenate nucleophilic heteroatom-containing substrates.." p. 576
12903042 Data show that the frequencies of FMO3 mutant alleles varied not only in different ethnic groups, but also in different populations that stemmed from the same ethnic group.
12903042 Observational study of genotype prevalence. (HuGE Navigator)
12814961 Observational study of genotype prevalence. (HuGE Navigator)
12814961 two new polymorphisms, His132-FMO3 and Pro360-FMO3, were identified; the effect of the amino acid substitutions on the function of FMO3 was evaluated
11809920 These data suggest that birth is necessary, but not sufficient for the onset of FMO3 expression. A gender-independent increase in FMO3 expression was observed from 11 to 18 y of age.
11717182 Observational study of genotype prevalence. (HuGE Navigator)

AA Sequence

MGKKVAIIGAGVSGLASIRSCLEEGLEPTCFEKSNDIGGLWKFSDHAEEGRASIYKSVFSNSSKEMMCFP      1 - 70
DFPFPDDFPNFMHNSKIQEYIIAFAKEKNLLKYIQFKTFVSSVNKHPDFATTGQWDVTTERDGKKESAVF     71 - 140
DAVMVCSGHHVYPNLPKESFPGLNHFKGKCFHSRDYKEPGVFNGKRVLVVGLGNSGCDIATELSRTAEQV    141 - 210
MISSRSGSWVMSRVWDNGYPWDMLLVTRFGTFLKNNLPTAISDWLYVKQMNARFKHENYGLMPLNGVLRK    211 - 280
EPVFNDELPASILCGIVSVKPNVKEFTETSAIFEDGTIFEGIDCVIFATGYSFAYPFLDESIIKSRNNEI    281 - 350
ILFKGVFPPLLEKSTIAVIGFVQSLGAAIPTVDLQSRWAAQVIKGTCTLPSMEDMMNDINEKMEKKRKWF    351 - 420
GKSETIQTDYIVYMDELSSFIGAKPNIPWLFLTDPKLAMEVYFGPCSPYQFRLVGPGQWPGARNAILTQW    421 - 490
DRSLKPMQTRVVGRLQKPCFFFHWLKLFAIPILLIAVFLVLT                                491 - 532
//

Text Mined References (100)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26616280 2016 Oxidative stress-responsive transcription factor NRF2 is not indispensable for the human hepatic Flavin-containing monooxygenase-3 (FMO3) gene expression in HepG2 cells.
26519273 2015 Association of Flavin Monooxygenase Gene E158K Polymorphism with Chronic Heart Disease Risk.
26218418 2015 Emerging roles of flavin monooxygenase 3 in cholesterol metabolism and atherosclerosis.
25870212 2015 Fish Malodour syndrome in a child.
25849138 2015 Flavin-containing monooxygenase 3 as a potential player in diabetes-associated atherosclerosis.
25760532 2015 Potential for drug interactions mediated by polymorphic flavin-containing monooxygenase 3 in human livers.
25460299 2014 Regulation of flavin-containing mono-oxygenase (Fmo3) gene expression by steroids in mice and humans.
25288227 2014 Fish odor syndrome (trimethylaminuria) supporting the possible FMO3 down expression in childhood: a case report.
25224784 2014 Effect of two-linked mutations of the FMO3 gene on itopride metabolism in Chinese healthy volunteers.
24816252 2014 An atlas of genetic influences on human blood metabolites.
24448396 2014 Variation in P450 oxidoreductase (POR) A503V and flavin-containing monooxygenase (FMO)-3 E158K is associated with minor alterations in nicotine metabolism, but does not alter cigarette consumption.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24173915 2014 Effects of single-nucleotide polymorphisms of FMO3 and FMO6 genes on pharmacokinetic characteristics of sulindac sulfide in premature labor.
24028545 2014 Relationships between flavin-containing mono-oxygenase 3 (FMO3) genotype and trimethylaminuria phenotype in a Japanese population.
23855261 2014 Metabolism and disposition of the dipeptidyl peptidase IV inhibitor teneligliptin in humans.
23791655 2013 Trimethylaminuria (fish odor syndrome): genotype characterization among Portuguese patients.
23567996 2013 Survey of variants of human flavin-containing monooxygenase 3 (FMO3) and their drug oxidation activities.
23510775 2013 Flavin containing monooxygenase 3 genetic polymorphisms Glu158Lys and Glu308Gly and their relation to ischemic stroke.
23350966 Inflammation in the setting of chronic allograft dysfunction post-kidney transplant: phenotype and genotype.
23266626 2013 FMO3 allelic variants in Sicilian and Sardinian populations: trimethylaminuria and absence of fish-like body odor.
23211429 2013 Effects upon in-vivo nicotine metabolism reveal functional variation in FMO3 associated with cigarette consumption.
23147717 2013 Influence of FMO1 and 3 polymorphisms on serum olanzapine and its N-oxide metabolite in psychiatric patients.
22903471 2013 Genome-wide association identifies genetic variants associated with lentiform nucleus volume in N?=?1345 young and elderly subjects.
22819296 2012 Variants in the flavin-containing monooxygenase 3 (FMO3) gene responsible for trimethylaminuria in a Japanese population.
22409263 2012 Flavin-containing monooxygenase 3 gene polymorphisms in Turkish population.
21075259 2010 What have we here? A man or a fish?
20734064 2010 A large-scale candidate gene association study of age at menarche and age at natural menopause.
20679960 2010 Pharmacogenetic analysis of lipid responses to rosuvastatin in Chinese patients.
20529763 2010 Evaluation of candidate genes for cholinesterase activity in farmworkers exposed to organophosphorus pesticides: association of single nucleotide polymorphisms in BCHE.
20198379 2010 A common FMO3 polymorphism may amplify the effect of nicotine exposure in sudden infant death syndrome (SIDS).
20182906 2011 Influence of pharmacogenetic variability on the pharmacokinetics and toxicity of the aurora kinase inhibitor danusertib.
20173083 2010 Genetic variation in metabolizing enzyme and transporter genes: comprehensive assessment in 3 major East Asian subpopulations with comparison to Caucasians and Africans.
20056567 2010 Childhood brain tumors, residential insecticide exposure, and pesticide metabolism genes.
19898482 2009 Genetic variants in TPMT and COMT are associated with hearing loss in children receiving cisplatin chemotherapy.
19761368 2009 Flavin-containing monooxygenase 3 polymorphisms in 13 ethnic populations from Europe, East Asia and sub-Saharan Africa: frequency and linkage analysis.
19577495 A novel mutation in the flavin-containing monooxygenase 3 gene (FMO3) of a Norwegian family causes trimethylaminuria.
19571433 2009 Inter-individual variation in flavin-containing monooxygenase 3 in livers from Japanese: correlation with hepatic transcription factors.
19356079 2008 Analysis of flavin-containing monooxygenase 3 genotype data in populations administered the anti-schizophrenia agent olanzapine.
19336370 2009 Determination of genetic predisposition to patent ductus arteriosus in preterm infants.
19321370 2009 Novel variants of the human flavin-containing monooxygenase 3 (FMO3) gene associated with trimethylaminuria.
18443301 2008 Revealing the moonlighting role of NADP in the structure of a flavin-containing monooxygenase.
18305374 2008 Complex mechanism underlying transcriptional control of the haplotyped flavin-containing monooxygenase 3 (FMO3) gene in Japanese: different regulation between mutations in 5'-upstream distal region and common element in proximal region.
18180394 2008 Genetic variation within adrenergic pathways determines in vivo effects of presynaptic stimulation in humans.
17885620 2007 Molecular evolution and balancing selection in the flavin-containing monooxygenase 3 gene (FMO3).
17881660 2007 Cyclic conversion of the novel Src kinase inhibitor [7-(2,6-dichloro-phenyl)-5-methyl-benzo[1,2,4]triazin-3-yl]-[4-(2-pyrrolidin-1-yl-ethoxy)-phenyl]-amine (TG100435) and Its N-oxide metabolite by flavin-containing monoxygenases and cytochrome P450 reductase.
17786630 2007 Mechanisms regulating human FMO3 transcription.
17584019 2007 Genetic polymorphism of the flavin-containing monooxygenase 3 (FMO3) associated with trimethylaminuria (fish odor syndrome): observations from Japanese patients.
17559352 2007 Genetic polymorphisms of human flavin-containing monooxygenase 3: implications for drug metabolism and clinical perspectives.
17531949 2007 Functional characterization of genetic variants of human FMO3 associated with trimethylaminuria.
17257434 2007 Transient trimethylaminuria related to menstruation.
17142560 2007 Effect of genetic variants of the human flavin-containing monooxygenase 3 on N- and S-oxygenation activities.
17096187 2006 Haplotype frequency distribution and linkage disequilibrium analysis of single nucleotide polymorphisms at the human FMO3 gene locus.
17050781 2007 Identification and functional analysis of common human flavin-containing monooxygenase 3 genetic variants.
16996766 2007 Stop codon mutations in the flavin-containing monooxygenase 3 (FMO3) gene responsible for trimethylaminuria in a Japanese population.
16863467 2006 Developmental and tissue-specific expression of human flavin-containing monooxygenases 1 and 3.
16858129 2006 Three novel single nucleotide polymorphisms of the FMO3 gene in a Japanese population.
16800822 2006 Effects of genetic polymorphisms of MDR1, FMO3 and CYP1A2 on susceptibility to colorectal cancer in Koreans.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16600650 2006 A spectrum of molecular variation in a cohort of Italian families with trimethylaminuria: identification of three novel mutations of the FM03 gene.
16598836 Allele and genotype frequencies of polymorphic FMO3 gene in two genetically distinct populations.
16481213 2006 Mutation, polymorphism and perspectives for the future of human flavin-containing monooxygenase 3.
16324215 2005 Polymorphisms of the Flavin containing monooxygenase 3 (FMO3) gene do not predispose to essential hypertension in Caucasians.
16214918 2005 Genetic polymorphisms of flavin monooxygenase 3 in sulindac-induced regression of colorectal adenomas in familial adenomatous polyposis.
16183778 2006 Quantitative analysis of FMO gene mRNA levels in human tissues.
15623613 2004 Genetic polymorphisms of human flavin monooxygenase 3 in sulindac-mediated primary chemoprevention of familial adenomatous polyposis.
15618753 2003 Two novel single nucleotide polymorphisms (SNPs) of the FMO3 gene in Japanese.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15203093 2004 The implications of polymorphisms in mammalian flavin-containing monooxygenases in drug discovery and development.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12903042 2003 [The frequency distribution of flavin-containing monooxygenase 3 mutant alleles in 28 populations from Yunnan].
12893987 2003 Deleterious mutations in the flavin-containing monooxygenase 3 (FMO3) gene causing trimethylaminuria.
12814961 2003 Two new polymorphisms of the FMO3 gene in Caucasian and African-American populations: comparative genetic and functional studies.
12527699 2003 Identification of novel variants of the flavin-containing monooxygenase gene family in African Americans.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11809920 2002 Human hepatic flavin-containing monooxygenases 1 (FMO1) and 3 (FMO3) developmental expression.
11717182 2001 Population distribution of human flavin-containing monooxygenase form 3: gene polymorphisms.
11551524 2001 Quantification and cellular localization of expression in human skin of genes encoding flavin-containing monooxygenases and cytochromes P450.
11266081 2001 A novel deletion in the flavin-containing monooxygenase gene (FMO3) in a Greek patient with trimethylaminuria.
11191884 2000 Compound heterozygosity for missense mutations in the flavin-containing monooxygenase 3 (FM03) gene in patients with fish-odour syndrome.
10479479 1999 Trimethylaminuria is caused by mutations of the FMO3 gene in a North American cohort.
10338091 1999 Two novel mutations of the FMO3 gene in a proband with trimethylaminuria.
9536088 1998 Mutations of the flavin-containing monooxygenase gene (FMO3) cause trimethylaminuria, a defect in detoxication.
9417913 1997 Structural organization of the human flavin-containing monooxygenase 3 gene (FMO3), the favored candidate for fish-odor syndrome, determined directly from genomic DNA.
9398858 1997 Missense mutation in flavin-containing mono-oxygenase 3 gene, FMO3, underlies fish-odour syndrome.
9224773 1997 Baculovirus-mediated expression and purification of human FMO3: catalytic, immunochemical, and structural characterization.
9207220 1997 Oxidation of caffeine to theobromine and theophylline is catalyzed primarily by flavin-containing monooxygenase in liver microsomes.
8654418 1996 Differential developmental and tissue-specific regulation of expression of the genes encoding three members of the flavin-containing monooxygenase family of man, FMO1, FMO3 and FM04.
8486388 1993 Localization of genes encoding three distinct flavin-containing monooxygenases to human chromosome 1q.
8128486 1994 The mammalian flavin-containing monooxygenases: molecular characterization and regulation of expression.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
8117928 Stereoselective metabolism of (S)-(-)-nicotine in humans: formation of trans-(S)-(-)-nicotine N-1'-oxide.
8104117 Chemical, enzymatic, and human enantioselective S-oxygenation of cimetidine.
7749747 1995 Flavin-containing monooxygenase mediated metabolism of psychoactive drugs by human brain microsomes.
7720103 1995 Role of hepatic flavin-containing monooxygenase 3 in drug and chemical metabolism in adult humans.
7568243 1995 Molecular cloning of the flavin-containing monooxygenase (form II) cDNA from adult human liver.
5048998 1972 Trimethylamine N-oxide synthesis: a human variant.
4195988 1970 Trimethylaminuria: the fish-odour syndrome.
2203193 1990 Flavin-containing monooxygenases: enzymes adapted for multisubstrate specificity.
1542660 1992 Molecular cloning of the flavin-containing monooxygenase (form II) cDNA from adult human liver.