Property Summary

NCBI Gene PubMed Count 36
PubMed Score 18.46
PubTator Score 51.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (26)

Gene RIF (10)

PMID Text
20529763 Observational study of gene-disease association. (HuGE Navigator)
20173083 Observational study of genotype prevalence. (HuGE Navigator)
19898482 Observational study of gene-disease association. (HuGE Navigator)
19420133 Characterization of sulfoxygenation and structural implications of human flavin-containing monooxygenase isoform 2 (FMO2.1) variants S195L and N413K.
18794725 analysis of how the functional variant flavin-containing monooxygenase 2*1 is at high frequency throughout sub-Saharan Africa
18794725 Observational study of genotype prevalence. (HuGE Navigator)
15864117 Observational study of genotype prevalence. (HuGE Navigator)
15864117 analysis of flavin-containing monooxygenase isoform 2 (FMO2) polymorphisms in Hispanics
15355885 Observational study of genotype prevalence. (HuGE Navigator)
11042094 Observational study of genotype prevalence. (HuGE Navigator)

AA Sequence

MAKKVAVIGAGVSGLISLKCCVDEGLEPTCFERTEDIGGVWRFKENVEDGRASIYQSVVTNTSKEMSCFS      1 - 70
DFPMPEDFPNFLHNSKLLEYFRIFAKKFDLLKYIQFQTTVLSVRKCPDFSSSGQWKVVTQSNGKEQSAVF     71 - 140
DAVMVCSGHHILPHIPLKSFPGMERFKGQYFHSRQYKHPDGFEGKRILVIGMGNSGSDIAVELSKNAAQV    141 - 210
FISTRHGTWVMSRISEDGYPWDSVFHTRFRSMLRNVLPRTAVKWMIEQQMNRWFNHENYGLEPQNKYIMK    211 - 280
EPVLNDDVPSRLLCGAIKVKSTVKELTETSAIFEDGTVEENIDVIIFATGYSFSFPFLEDSLVKVENNMV    281 - 350
SLYKYIFPAHLDKSTLACIGLIQPLGSIFPTAELQARWVTRVFKGLCSLPSERTMMMDIIKRNEKRIDLF    351 - 420
GESQSQTLQTNYVDYLDELALEIGAKPDFCSLLFKDPKLAVRLYFGPCNSY                       421 - 471
//

Text Mined References (37)

PMID Year Title
24561181 2014 Mammalian flavin-containing monooxygenase (FMO) as a source of hydrogen peroxide.
22830265 2012 [Association of rs10912745 and rs4916375 polymorphisms located in the cluster of flavin-containing monooxygenase genes, with ischaemic cardioembolic stroke].
20529763 2010 Evaluation of candidate genes for cholinesterase activity in farmworkers exposed to organophosphorus pesticides: association of single nucleotide polymorphisms in BCHE.
20388717 2010 In vivo identification of sumoylation sites by a signature tag and cysteine-targeted affinity purification.
20173083 2010 Genetic variation in metabolizing enzyme and transporter genes: comprehensive assessment in 3 major East Asian subpopulations with comparison to Caucasians and Africans.
19898482 2009 Genetic variants in TPMT and COMT are associated with hearing loss in children receiving cisplatin chemotherapy.
19420133 2009 Characterization of sulfoxygenation and structural implications of human flavin-containing monooxygenase isoform 2 (FMO2.1) variants S195L and N413K.
18948378 2009 Human flavin-containing monooxygenase 2.1 catalyzes oxygenation of the antitubercular drugs thiacetazone and ethionamide.
18930751 2008 Metabolism of the anti-tuberculosis drug ethionamide by mouse and human FMO1, FMO2 and FMO3 and mouse and human lung microsomes.
18794725 2008 The potentially deleterious functional variant flavin-containing monooxygenase 2*1 is at high frequency throughout sub-Saharan Africa.
18423897 2008 Flavin-containing monooxygenases: mutations, disease and drug response.
18234543 2008 CPA6, FMO2, LGI1, SIAT1 and TNC are differentially expressed in early- and late-stage oral squamous cell carcinoma--a pilot study.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16428471 2006 High-resolution genomic profiling reveals association of chromosomal aberrations on 1q and 16p with histologic and genetic subgroups of invasive breast cancer.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16183778 2006 Quantitative analysis of FMO gene mRNA levels in human tissues.
15922018 2005 Mammalian flavin-containing monooxygenases: structure/function, genetic polymorphisms and role in drug metabolism.
15864117 2005 Haplotype and functional analysis of four flavin-containing monooxygenase isoform 2 (FMO2) polymorphisms in Hispanics.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15355885 2004 Differences in FMO2*1 allelic frequency between Hispanics of Puerto Rican and Mexican descent.
15294458 2004 S-oxygenation of the thioether organophosphate insecticides phorate and disulfoton by human lung flavin-containing monooxygenase 2.
15155844 2004 Alternative processing events in human FMO genes.
15144220 2004 Human flavin-containing monooxygenase form 2 S-oxygenation: sulfenic acid formation from thioureas and oxidation of glutathione.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12527699 2003 Identification of novel variants of the flavin-containing monooxygenase gene family in African Americans.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12214664 2002 Genetic polymorphisms of flavin-containing monooxygenase (FMO).
11744609 2002 Identification of active flavin-containing monooxygenase isoform 2 in human lung and characterization of expressed protein.
11042094 2000 Ethnic differences in human flavin-containing monooxygenase 2 (FMO2) polymorphisms: detection of expressed protein in African-Americans.
9804831 1998 The flavin-containing monooxygenase 2 gene (FMO2) of humans, but not of other primates, encodes a truncated, nonfunctional protein.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8786146 1996 Localization of human flavin-containing monooxygenase genes FMO2 and FMO5 to chromosome 1q.
8311461 1994 A nomenclature for the mammalian flavin-containing monooxygenase gene family based on amino acid sequence identities.
8128486 1994 The mammalian flavin-containing monooxygenases: molecular characterization and regulation of expression.
7720101 1995 The molecular biology of the flavin-containing monooxygenases of man.
1542660 1992 Molecular cloning of the flavin-containing monooxygenase (form II) cDNA from adult human liver.
1417778 1992 Cloning, primary sequence and chromosomal localization of human FMO2, a new member of the flavin-containing mono-oxygenase family.