Property Summary

NCBI Gene PubMed Count 35
PubMed Score 31.77
PubTator Score 52.19

Knowledge Summary

Patent

No data available

Expression

Protein-protein Interaction (2)

Gene RIF (16)

PMID Text
23147717 data support the role of FMO3 in the N-oxidation of OLA and implicate for the first time the contribution of FMO1 and its functional *6 variant in OLA disposition
21540762 polymorphisms in FMO1 are significant risk factors in the development of nicotine dependence and that the mechanism may involve variation in nicotine pharmacology.
21082301 The results of this study suggested that the alteration of FMO gene expression is a consequence of the pathological environment linked to oxidative stress related to mutated SOD1.
20734064 Observational study of gene-disease association. (HuGE Navigator)
20529763 Observational study of gene-disease association. (HuGE Navigator)
20056567 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19898482 Observational study of gene-disease association. (HuGE Navigator)
19552509 The resulting data showed that N,N-dimethylamphetamine N-oxidation is mainly mediated by FMO1.
19336370 Observational study of gene-disease association. (HuGE Navigator)
17127561 Observational study of gene-disease association. (HuGE Navigator)
17127561 Specific allelic variants of the FMO1 gene might be associated to susceptibility to develop ALS.
16863467 Early studies described in this review document that FMO1 is the most abundant FMO enzyme in the human fetal liver, whereas FMO3 is essentially absent.
16183778 FMO1 was found to be down-regulated in human adult brain tissue.
15203093 "...in fetal liver, where FMO1 predominates attaining expression levels of (about) 32% of expressed CYP3A4." p. 574 "...recent examples indicate that FMOs play a prominent role in the metabolism ...of important drugs." p. 575
12829732 data from transient expression assays in HepG2 cells suggested this SNP could account for a 2- to 3-fold loss of FMO1 promoter activity.
11809920 FMO1 expression is restricted to the fetus; FMO1 suppression occurred within 3 d postpartum in a process tightly coupled to birth, but not gestational age.

AA Sequence

MAKRVAIVGAGVSGLASIKCCLEEGLEPTCFERSDDLGGLWRFTEHVEEGRASLYKSVVSNSCKEMSCYS      1 - 70
DFPFPEDYPNYVPNSQFLEYLKMYANHFDLLKHIQFKTKVCSVTKCSDSAVSGQWEVVTMHEEKQESAIF     71 - 140
DAVMVCTGFLTNPYLPLDSFPGINAFKGQYFHSRQYKHPDIFKDKRVLVIGMGNSGTDIAVEASHLAEKV    141 - 210
FLSTTGGGWVISRIFDSGYPWDMVFMTRFQNMLRNSLPTPIVTWLMERKINNWLNHANYGLIPEDRTQLK    211 - 280
EFVLNDELPGRIITGKVFIRPSIKEVKENSVIFNNTSKEEPIDIIVFATGYTFAFPFLDESVVKVEDGQA    281 - 350
SLYKYIFPAHLQKPTLAIIGLIKPLGSMIPTGETQARWAVRVLKGVNKLPPPSVMIEEINARKENKPSWF    351 - 420
GLCYCKALQSDYITYIDELLTYINAKPNLFSMLLTDPHLALTVFFGPCSPYQFRLTGPGKWEGARNAIMT    421 - 490
QWDRTFKVIKARVVQESPSPFESFLKVFSFLALLVAIFLIFL                                491 - 532
//

Text Mined References (35)

PMID Year Title
23147717 2013 Influence of FMO1 and 3 polymorphisms on serum olanzapine and its N-oxide metabolite in psychiatric patients.
21658281 2011 GWAS for discovery and replication of genetic loci associated with sudden cardiac arrest in patients with coronary artery disease.
21540762 2011 Common polymorphisms in FMO1 are associated with nicotine dependence.
21082301 2011 Flavin-containing monooxygenase mRNA levels are up-regulated in als brain areas in SOD1-mutant mice.
20734064 2010 A large-scale candidate gene association study of age at menarche and age at natural menopause.
20529763 2010 Evaluation of candidate genes for cholinesterase activity in farmworkers exposed to organophosphorus pesticides: association of single nucleotide polymorphisms in BCHE.
20056567 2010 Childhood brain tumors, residential insecticide exposure, and pesticide metabolism genes.
19898482 2009 Genetic variants in TPMT and COMT are associated with hearing loss in children receiving cisplatin chemotherapy.
19552509 2009 Flavin-containing monooxygenase 1-catalysed N,N-dimethylamphetamine N-oxidation.
19336370 2009 Determination of genetic predisposition to patent ductus arteriosus in preterm infants.
19262426 2009 Deletion of the mouse Fmo1 gene results in enhanced pharmacological behavioural responses to imipramine.
17127561 2006 Increased incidence of FMO1 gene single nucleotide polymorphisms in sporadic amyotrophic lateral sclerosis.
16863467 2006 Developmental and tissue-specific expression of human flavin-containing monooxygenases 1 and 3.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16531493 2006 Salicylic acid-independent ENHANCED DISEASE SUSCEPTIBILITY1 signaling in Arabidopsis immunity and cell death is regulated by the monooxygenase FMO1 and the Nudix hydrolase NUDT7.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16183778 2006 Quantitative analysis of FMO gene mRNA levels in human tissues.
15987777 2005 Oxidation of tamoxifen by human flavin-containing monooxygenase (FMO) 1 and FMO3 to tamoxifen-N-oxide and its novel reduction back to tamoxifen by human cytochromes P450 and hemoglobin.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15203093 2004 The implications of polymorphisms in mammalian flavin-containing monooxygenases in drug discovery and development.
15144220 2004 Human flavin-containing monooxygenase form 2 S-oxygenation: sulfenic acid formation from thioureas and oxidation of glutathione.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12829732 2003 Genetic variability at the human FMO1 locus: significance of a basal promoter yin yang 1 element polymorphism (FMO1*6).
12642475 2003 Cytochrome P450 2C8 and flavin-containing monooxygenases are involved in the metabolism of tazarotenic acid in humans.
12527699 2003 Identification of novel variants of the flavin-containing monooxygenase gene family in African Americans.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11809920 2002 Human hepatic flavin-containing monooxygenases 1 (FMO1) and 3 (FMO3) developmental expression.
11725960 2001 Identification of human drug-metabolizing enzymes involved in the metabolism of SNI-2011.
10950857 2000 Immunoquantitation of FMO1 in human liver, kidney, and intestine.
9094723 1997 Protein interactions regulating vesicle transport between the endoplasmic reticulum and Golgi apparatus in mammalian cells.
8486388 1993 Localization of genes encoding three distinct flavin-containing monooxygenases to human chromosome 1q.
8311461 1994 A nomenclature for the mammalian flavin-containing monooxygenase gene family based on amino acid sequence identities.
8128486 1994 The mammalian flavin-containing monooxygenases: molecular characterization and regulation of expression.
7720101 1995 The molecular biology of the flavin-containing monooxygenases of man.
1712018 1991 Cloning, primary sequence, and chromosomal mapping of a human flavin-containing monooxygenase (FMO1).