Property Summary

NCBI Gene PubMed Count 25
PubMed Score 15.66
PubTator Score 15.30

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
osteosarcoma 2.273 5.7e-05
cystic fibrosis 2.149 9.2e-07
atypical teratoid / rhabdoid tumor -1.400 2.9e-03
juvenile dermatomyositis 1.214 1.8e-08
primary pancreatic ductal adenocarcinoma 1.301 1.1e-02
tuberculosis 1.100 4.2e-02
intraductal papillary-mucinous adenoma (... 1.300 7.8e-03
breast carcinoma -1.200 1.1e-05
nasopharyngeal carcinoma 1.700 1.7e-06
psoriasis -1.300 4.3e-04
Pick disease 1.500 2.4e-05
gastric carcinoma 1.200 1.6e-02
ovarian cancer 1.500 5.0e-04
pituitary cancer -2.100 8.6e-04
pancreatic cancer 1.200 2.0e-02

Gene RIF (15)

PMID Text
26564775 Capping protein and FMNL2 functionally coregulate filament barbed-end assembly.
26515696 miR-206 functioned as a tumor suppressor in the progression of colorectal cancer(CRC) by targeting FMNL2 and c-MET. Restoration of miR-206 expression may represent a promising therapeutic approach for targeting malignant CRC.
26256210 These data establish a role for FMNL2 in the regulation of beta1-integrin and provide a mechanistic understanding of the function of FMNL2 in cancer invasiveness.
26103003 MiR-34a was down-regulated in colorectal cancer cells and inversely correlated with FMNL2 and E2F5 expressions. Our study suggests that miR-34a is an important tumor suppressor of CRC progression by targeting FMNL2 and E2F5.
25963818 Rac1-induced actin assembly and subsequent AJ formation critically depends on FMNL2.
25963737 The two interacting FMNL-Cdc42 heterodimers expose six membrane interaction motifs on a convex protein surface, the assembly of which may facilitate actin filament elongation at the leading edge of lamellipodia and filopodia.
23201162 miR-137, induced by its upstream transcription factor HMGA1, can suppress colorectal cancer cell invasion and metastasis by targeting FMNL2.
22790947 Protein N-myristoylation plays critical roles in the cellular morphological changes induced by FMNL2 and FMNL3.
22608513 FMNL2 is a novel elongation factor of actin filaments that constitutes the first Cdc42 effector promoting cell migration and actin polymerization at the tips of lamellipodia.
21496865 formin-like 2 expression correlated positively with tumor differentiation (P = .046) and vascular invasion (P = .008). Patients whose tumors had lower formin-like 2 expression had shorter overall survival times
21071512 Findings identify a novel EMT and tumor promoting function for FMNL2, which is involved in TGF-beta-induced EMT and colorectal carcinoma cell invasion via Smad3 effectors, or in collaboration with MAPK/MEK pathway.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20101212 a novel regulatory and functional interaction between RhoC and FMNL2 for modulating cell shape and invasiveness and provide mechanistic insight into RhoC-specific signalling events.
19401682 Observational study of gene-disease association. (HuGE Navigator)
18665374 FMNL2 may play an important role in the metastasis of CRC and may be a useful marker for metastasis of CRC.

AA Sequence

MGNAGSMDSQQTDFRAHNVPLKLPMPEPGELEERFAIVLNAMNLPPDKARLLRQYDNEKKWELICDQERF      1 - 70
QVKNPPHTYIQKLKGYLDPAVTRKKFRRRVQESTQVLRELEISLRTNHIGWVREFLNEENKGLDVLVEYL     71 - 140
SFAQYAVTFDFESVESTVESSVDKSKPWSRSIEDLHRGSNLPSPVGNSVSRSGRHSALRYNTLPSRRTLK    141 - 210
NSRLVSKKDDVHVCIMCLRAIMNYQYGFNMVMSHPHAVNEIALSLNNKNPRTKALVLELLAAVCLVRGGH    211 - 280
EIILSAFDNFKEVCGEKQRFEKLMEHFRNEDNNIDFMVASMQFINIVVHSVEDMNFRVHLQYEFTKLGLD    281 - 350
EYLDKLKHTESDKLQVQIQAYLDNVFDVGALLEDAETKNAALERVEELEENISHLSEKLQDTENEAMSKI    351 - 420
VELEKQLMQRNKELDVVREIYKDANTQVHTLRKMVKEKEEAIQRQSTLEKKIHELEKQGTIKIQKKGDGD    421 - 490
IAILPVVASGTLSMGSEVVAGNSVGPTMGAASSGPLPPPPPPLPPSSDTPETVQNGPVTPPMPPPPPPPP    491 - 560
PPPPPPPPPPPPPLPGPAAETVPAPPLAPPLPSAPPLPGTSSPTVVFNSGLAAVKIKKPIKTKFRMPVFN    561 - 630
WVALKPNQINGTVFNEIDDERILEDLNVDEFEEIFKTKAQGPAIDLSSSKQKIPQKGSNKVTLLEANRAK    631 - 700
NLAITLRKAGKTADEICKAIHVFDLKTLPVDFVECLMRFLPTENEVKVLRLYERERKPLENLSDEDRFMM    701 - 770
QFSKIERLMQKMTIMAFIGNFAESIQMLTPQLHAIIAASVSIKSSQKLKKILEIILALGNYMNSSKRGAV    771 - 840
YGFKLQSLDLLLDTKSTDRKQTLLHYISNVVKEKYHQVSLFYNELHYVEKAAAVSLENVLLDVKELQRGM    841 - 910
DLTKREYTMHDHNTLLKEFILNNEGKLKKLQDDAKIAQDAFDDVVKYFGENPKTTPPSVFFPVFVRFVKA    911 - 980
YKQAEEENELRKKQEQALMEKLLEQEALMEQQDPKSPSHKSKRQQQELIAELRRRQVKDNRHVYEGKDGA    981 - 1050
IEDIITVLKTVPFTARTAKRGSRFFCEPVLTEEYHY                                     1051 - 1086
//

Text Mined References (32)

PMID Year Title
26564775 2015 Formin and capping protein together embrace the actin filament in a ménage à trois.
26515696 2016 MicroRNA-206 functions as a tumor suppressor in colorectal cancer by targeting FMNL2.
26256210 2015 Formin-like 2 Promotes ?1-Integrin Trafficking and Invasive Motility Downstream of PKC?.
26103003 2015 MicroRNA-34a targets FMNL2 and E2F5 and suppresses the progression of colorectal cancer.
25963818 2015 Junctional actin assembly is mediated by Formin-like 2 downstream of Rac1.
25963737 2015 The structure of FMNL2-Cdc42 yields insights into the mechanism of lamellipodia and filopodia formation.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
23201162 2013 MicroRNA-137, an HMGA1 target, suppresses colorectal cancer cell invasion and metastasis in mice by directly targeting FMNL2.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22790947 2012 Protein N-myristoylation is required for cellular morphological changes induced by two formin family proteins, FMNL2 and FMNL3.
22608513 2012 FMNL2 drives actin-based protrusion and migration downstream of Cdc42.
21834987 2011 Identification and characterization of a set of conserved and new regulators of cytoskeletal organization, cell morphology and migration.
21496865 2011 Down-regulation of formin-like 2 predicts poor prognosis in hepatocellular carcinoma.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21071512 2010 FMNL2 enhances invasion of colorectal carcinoma by inducing epithelial-mesenchymal transition.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20213681 2010 Strategy for comprehensive identification of human N-myristoylated proteins using an insect cell-free protein synthesis system.
20101212 2010 Formin-like 2 drives amoeboid invasive cell motility downstream of RhoC.
19401682 2010 High-density SNP association study and copy number variation analysis of the AUTS1 and AUTS5 loci implicate the IMMP2L-DOCK4 gene region in autism susceptibility.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18665374 2008 Overexpression of FMNL2 is closely related to metastasis of colorectal cancer.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231748 2004 Functional proteomics mapping of a human signaling pathway.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12684686 2003 Identification and characterization of human FMNL1, FMNL2 and FMNL3 genes in silico.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11572484 2001 Prediction of the coding sequences of unidentified human genes. XXI. The complete sequences of 60 new cDNA clones from brain which code for large proteins.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.
1538749 1992 Sequence identification of 2,375 human brain genes.