Property Summary

NCBI Gene PubMed Count 28
PubMed Score 51.79
PubTator Score 20.45

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
astrocytic glioma 1.300 1.7e-02
ependymoma 1.200 3.6e-02
oligodendroglioma 1.200 2.7e-02
cystic fibrosis -1.173 9.9e-05
atypical teratoid / rhabdoid tumor -3.400 2.2e-05
glioblastoma -1.500 7.1e-03
medulloblastoma, large-cell -2.800 6.6e-04
primitive neuroectodermal tumor -1.400 2.2e-02
pediatric high grade glioma -1.100 1.1e-02
sonic hedgehog group medulloblastoma -1.800 1.5e-03
lung carcinoma 2.200 4.9e-13
ovarian cancer -1.100 9.9e-06
pituitary cancer 1.500 1.6e-06
chronic rhinosinusitis -1.161 3.1e-02

 GO Function (1)

Gene RIF (18)

PMID Text
26764407 Disease causing mutations in inverted formin 2 regulate its binding to G-actin, F-actin capping protein (CapZ alpha-1) and profilin 2.
26287480 This DNA damage-induced nuclear actin assembly requires two biologically and physically linked nucleation factors: Formin-2 and Spire-1/Spire-2.
25564607 We therefore characterized co-expressed Spir-2 and Fmn-2 fluorescent protein fusions . The data corroborate a model according to which Spir-2 exists in two different states, a cytosolic monomeric conformation and a membrane-bound state
25480035 FMN2 mutations link intellectual disability either directly or indirectly to the regulation of actin-mediated synaptic spine density.
24223803 miR-335 regulates the expression of at least five formin family members, three of which are validated, FMNL3, FMN2 and DAAM2.
23839046 FMN2 is a crucial protein involved in the control of p21.
23375502 results identify FMN2 as a crucial component in the regulation of p21 and consequent oncogene/stress-induced cell-cycle arrest in human cells.
21705804 analysis of the molecular basis of the Spir1/formin-2 interaction
20734064 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19955471 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19626040 Observational study of gene-disease association. (HuGE Navigator)
19605360 both mammalian Spir proteins, Spir-1 and Spir-2, interact with mammalian Fmn subgroup proteins formin-1 and formin-2
19336575 Observational study of gene-disease association. (HuGE Navigator)
15866570 It is likely that FMN2 has the same function as Fmn2 in the mouse, i.e., maintenance of the meiotic spindle. Identification of patients with meiosis I arrest is necessary to determine whether FMN2 mutations are a cause of unexplained infertility.
15289902 FMN2 was characterized at human chromosome 1q43.

AA Sequence

MGNQDGKLKRSAGDALHEGGGGAEDALGPRDVEATKKGSGGKKALGKHGKGGGGGGGGGESGKKKSKSDS      1 - 70
RASVFSNLRIRKNLSKGKGAGGSREDVLDSQALQTGELDSAHSLLTKTPDLSLSADEAGLSDTECADPFE     71 - 140
VTGPGGPGPAEARVGGRPIAEDVETAAGAQDGQRTSSGSDTDIYSFHSATEQEDLLSDIQQAIRLQQQQQ    141 - 210
QQLQLQLQQQQQQQQLQGAEEPAAPPTAVSPQPGAFLGLDRFLLGPSGGAGEAPGSPDTEQALSALSDLP    211 - 280
ESLAAEPREPQQPPSPGGLPVSEAPSLPAAQPAAKDSPSSTAFPFPEAGPGEEAAGAPVRGAGDTDEEGE    281 - 350
EDAFEDAPRGSPGEEWAPEVGEDAPQRLGEEPEEEAQGPDAPAAASLPGSPAPSQRCFKPYPLITPCYIK    351 - 420
TTTRQLSSPNHSPSQSPNQSPRIKRRPEPSLSRGSRTALASVAAPAKKHRADGGLAAGLSRSADWTEELG    421 - 490
ARTPRVGGSAHLLERGVASDSGGGVSPALAAKASGAPAAADGFQNVFTGRTLLEKLFSQQENGPPEEAEK    491 - 560
FCSRIIAMGLLLPFSDCFREPCNQNAQTNAASFDQDQLYTWAAVSQPTHSLDYSEGQFPRRVPSMGPPSK    561 - 630
PPDEEHRLEDAETESQSAVSETPQKRSDAVQKEVVDMKSEGQATVIQQLEQTIEDLRTKIAELERQYPAL    631 - 700
DTEVASGHQGLENGVTASGDVCLEALRLEEKEVRHHRILEAKSIQTSPTEEGGVLTLPPVDGLPGRPPCP    701 - 770
PGAESGPQTKFCSEISLIVSPRRISVQLDSHQPTQSISQPPPPPSLLWSAGQGQPGSQPPHSISTEFQTS    771 - 840
HEHSVSSAFKNSCNIPSPPPLPCTESSSSMPGLGMVPPPPPPLPGMTVPTLPSTAIPQPPPLQGTEMLPP    841 - 910
PPPPLPGAGIPPPPPLPGAGILPLPPLPGAGIPPPPPLPGAAIPPPPPLPGAGIPLPPPLPGAGIPPPPP    911 - 980
LPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGA    981 - 1050
GIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGVGIPPPPPLPGAGIPP   1051 - 1120
PPPLPGAGIPPPPPLPGAGIPPPPPLPRVGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGVGIPPPPPL   1121 - 1190
PGVGIPPPPPLPGAGIPPPPPLPGMGIPPAPAPPLPPPGTGIPPPPLLPVSGPPLLPQVGSSTLPTPQVC   1191 - 1260
GFLPPPLPSGLFGLGMNQDKGSRKQPIEPCRPMKPLYWTRIQLHSKRDSSTSLIWEKIEEPSIDCHEFEE   1261 - 1330
LFSKTAVKERKKPISDTISKTKAKQVVKLLSNKRSQAVGILMSSLHLDMKDIQHAVVNLDNSVVDLETLQ   1331 - 1400
ALYENRAQSDELEKIEKHGRSSKDKENAKSLDKPEQFLYELSLIPNFSERVFCILFQSTFSESICSIRRK   1401 - 1470
LELLQKLCETLKNGPGVMQVLGLVLAFGNYMNGGNKTRGQADGFGLDILPKLKDVKSSDNSRSLLSYIVS   1471 - 1540
YYLRNFDEDAGKEQCLFPLPEPQDLFQASQMKFEDFQKDLRKLKKDLKACEVEAGKVYQVSSKEHMQPFK   1541 - 1610
ENMEQFIIQAKIDQEAEENSLTETHKCFLETTAYFFMKPKLGEKEVSPNAFFSIWHEFSSDFKDFWKKEN   1611 - 1680
KLLLQERVKEAEEVCRQKKGKSLYKIKPRHDSGIKAKISMKT                               1681 - 1722
//

Text Mined References (31)

PMID Year Title
26764407 2016 Disease causing mutations in inverted formin 2 regulate its binding to G-actin, F-actin capping protein (CapZ ?-1) and profilin 2.
26287480 2015 DNA damage induces nuclear actin filament assembly by Formin -2 and Spire-½ that promotes efficient DNA repair. [corrected].
25564607 2015 Membrane targeting of the Spir·formin actin nucleator complex requires a sequential handshake of polar interactions.
25480035 2014 Biallelic truncating mutations in FMN2, encoding the actin-regulatory protein Formin 2, cause nonsyndromic autosomal-recessive intellectual disability.
24489884 2014 Genome-wide association study of proneness to anger.
24223803 2013 Metastasis suppressor microRNA-335 targets the formin family of actin nucleators.
23839046 2013 FMN2 is a novel regulator of the cyclin-dependent kinase inhibitor p21.
23535033 2014 Genome-wide association study of the rate of cognitive decline in Alzheimer's disease.
23437003 2013 Genetic determinants of trabecular and cortical volumetric bone mineral densities and bone microstructure.
23400010 2014 Genome-wide association analyses suggest NELL1 influences adverse metabolic response to HCTZ in African Americans.
23375502 2013 Identification and functional characterization of FMN2, a regulator of the cyclin-dependent kinase inhibitor p21.
22330775 2012 Differential role of actin-binding proteins in controlling the adipogenic differentiation of human CD105-positive Wharton's Jelly cells.
21730168 2011 Structure and function of the interacting domains of Spire and Fmn-family formins.
21705804 2011 Molecular basis of actin nucleation factor cooperativity: crystal structure of the Spir-1 kinase non-catalytic C-lobe domain (KIND)•formin-2 formin SPIR interaction motif (FSI) complex.
20734064 2010 A large-scale candidate gene association study of age at menarche and age at natural menopause.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20082305 2010 Effects of genistein on beta-catenin signaling and subcellular distribution of actin-binding proteins in human umbilical CD105-positive stromal cells.
19955471 2010 Genetic variants identified in a European genome-wide association study that were found to predict incident coronary heart disease in the atherosclerosis risk in communities study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19626040 2009 Follow-up examination of linkage and association to chromosome 1q43 in multiple sclerosis.
19605360 2009 Identification of a short Spir interaction sequence at the C-terminal end of formin subgroup proteins.
19336575 2009 Genetic analysis of coronary artery disease single-nucleotide polymorphisms in diabetic nephropathy.
17554300 2007 Genome-wide association study of 14,000 cases of seven common diseases and 3,000 shared controls.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15866570 2005 Characterization and mutation analysis of the human formin-2 (FMN2) gene in women with unexplained infertility.
15289902 2004 Characterization of FMN2 gene at human chromosome 1q43.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12447394 2002 Formin-2, polyploidy, hypofertility and positioning of the meiotic spindle in mouse oocytes.
10781961 2000 Formin-2, a novel formin homology protein of the cappuccino subfamily, is highly expressed in the developing and adult central nervous system.