Property Summary

NCBI Gene PubMed Count 17
PubMed Score 550.03
PubTator Score 576.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Gene RIF (8)

PMID Text
21975549 Filopodia initiation: focus on the Arp2/3 complex and formins.
20610440 Chromosomal imbalances in the GREM1 FMN1 region in individuals with limb defects are reported here.
20540360 The obtained data indicate the possibility of participation of polymorphism in gene FMN1 in formation of predisposition to prostate cancer.
20540360 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20200978 Observational study of gene-disease association. (HuGE Navigator)
19605360 both mammalian Spir proteins, Spir-1 and Spir-2, interact with mammalian Fmn subgroup proteins formin-1 and formin-2
19096130 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MEGTHCTLQLHKPITELCYISFCLPKGEVRGFSYKGTVTLDRSNKGFHNCYQVREESDIISLSQEPDEHP      1 - 70
GDIFFKQTPTKDILTELYKLTTERERLLTNLLSSDHILGITMGNQEGKLQELSVSLAPEDDCFQSAGDWQ     71 - 140
GELPVGPLNKRSTHGNKKPRRSSGRRESFGALPQKRTKRKGRGGRESAPLMGKDKICSSHSLPLSRTRPN    141 - 210
LWVLEEKGNLLPNGALACSLQRRESCPPDIPKTPDTDLGFGSFETAFKDTGLGREVLPPDCSSTEAGGDG    211 - 280
IRRPPSGLEHQQTGLSESHQDPEKHPEAEKDEMEKPAKRTCKQKPVSKVVAKVQDLSSQVQRVVKTHSKG    281 - 350
KETIAIRPAAHAEFVPKADLLTLPGAEAGAHGSRRQGKERQGDRSSQSPAGETASISSVSASAEGAVNKV    351 - 420
PLKVIESEKLDEAPEGKRLGFPVHTSVPHTRPETRNKRRAGLPLGGHKSLFLDLPHKVGPDSSQPRGDKK    421 - 490
KPSPPAPAALGKVFNNSASQSSTHKQTSPVPSPLSPRLPSPQQHHRILRLPALPGEREAALNDSPCRKSR    491 - 560
VFSGCVSADTLEPPSSAKVTETKGASPAFLRAGQPRLVPGETLEKSLGPGKTTAEPQHQSPPGISSEGFP    561 - 630
WDGFNEQTPKDLPNRDGGAWVLGYRAGPACPFLLHEEREKSNRSELYLDLHPDHSLTEQDDRTPGRLQAV    631 - 700
WPPPKTKDTEEKVGLKYTEAEYQAAILHLKREHKEEIENLQAQFELRAFHIRGEHAMITARLEETIENLK    701 - 770
HELEHRWRGGCEERKDVCISTDDDCPPKTFRNVCVQTDRETFLKPCESESKTTRSNQLVPKKLNISSLSQ    771 - 840
LSPPNDHKDIHAALQPMEGMASNQQKALPPPPASIPPPPPLPSGLGSLSPAPPMPPVSAGPPLPPPPPPP    841 - 910
PPLPPPSSAGPPPPPPPPPLPNSPAPPNPGGPPPAPPPPGLAPPPPPGLFFGLGSSSSQCPRKPAIEPSC    911 - 980
PMKPLYWTRIQISDRSQNATPTLWDSLEEPDIRDPSEFEYLFSKDTTQQKKKPLSETYEKKNKVKKIIKL    981 - 1050
LDGKRSQTVGILISSLHLEMKDIQQAIFNVDDSVVDLETLAALYENRAQEDELVKIRKYYETSKEEELKL   1051 - 1120
LDKPEQFLHELAQIPNFAERAQCIIFRSVFSEGITSLHRKVEIITRASKDLLHVKSVKDILALILAFGNY   1121 - 1190
MNGGNRTRGQADGYSLEILPKLKDVKSRDNGINLVDYVVKYYLRYYDQEAGTEKSVFPLPEPQDFFLASQ   1191 - 1260
VKFEDLIKDLRKLKRQLEASEKQMVVVCKESPKEYLQPFKDKLEEFFQKAKKEHKMEESHLENAQKSFET   1261 - 1330
TVRYFGMKPKSGEKEITPSYVFMVWYEFCSDFKTIWKRESKNISKERLKMAQESVSKLTSEKKVETKKIN   1331 - 1400
PTASLKERLRQKEASVTTN                                                      1401 - 1419
//

Text Mined References (22)

PMID Year Title
24662972 2014 Genome-wide interaction study of smoking and bladder cancer risk.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23377640 2013 Common genetic variation and antidepressant efficacy in major depressive disorder: a meta-analysis of three genome-wide pharmacogenetic studies.
21975549 Filopodia initiation: focus on the Arp2/3 complex and formins.
20610440 2010 Genomic rearrangements of the GREM1-FMN1 locus cause oligosyndactyly, radio-ulnar synostosis, hearing loss, renal defects syndrome and Cenani--Lenz-like non-syndromic oligosyndactyly.
20540360 2010 [A study of the single nucleotide polymorphism in seven genes (GHR, IGFBP3, IGFR1, IRS1, FMN1, ANXA2, TaGLN) in ethnic Russians and in patients with prostate cancer].
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20200978 2010 Replication of previous genome-wide association studies of bone mineral density in premenopausal American women.
20023658 2010 Genome-wide association study identifies two susceptibility loci for nonsyndromic cleft lip with or without cleft palate.
19605360 2009 Identification of a short Spir interaction sequence at the C-terminal end of formin subgroup proteins.
19096130 2008 Microsatellite scan identifies new candidate genes for susceptibility to alcoholic chronic pancreatitis in Japanese patients.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15202026 2004 Identification and characterization of the human FMN1 gene in silico.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14647292 2004 Mammalian formin-1 participates in adherens junctions and polymerization of linear actin cables.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10631086 2000 Formin family proteins in cytoskeletal control.
10199968 1999 Formin defines a large family of morphoregulatory genes and functions in establishment of the polarising region.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
1673046 1991 A human gene homologous to the formin gene residing at the murine limb deformity locus: chromosomal location and RFLPs.