Property Summary

NCBI Gene PubMed Count 10
PubMed Score 15.63
PubTator Score 11.15

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (5)

Disease log2 FC p
oligodendroglioma 1.100 8.1e-14
osteosarcoma -1.239 1.4e-03
pancreatic ductal adenocarcinoma liver m... -1.464 3.8e-03
non primary Sjogren syndrome sicca 1.200 2.2e-02
ovarian cancer 1.300 1.5e-03

Gene RIF (1)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAALGSPSHTFRGLLRELRYLSAATGRPYRDTAAYRYLVKAFRAHRVTSEKLCRAQHELHFQAATYLCLL      1 - 70
RSIRKHVALHQEFHGKGERSVEESAGLVGLKLPHQPGGKGWEP                                71 - 113
//

Text Mined References (13)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16381901 2006 The LIFEdb database in 2006.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853948 2003 The DNA sequence of human chromosome 7.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11096112 2001 Identification of a nuclear gene (FMC1) required for the assembly/stability of yeast mitochondrial F(1)-ATPase in heat stress conditions.
11076863 2000 DNA cloning using in vitro site-specific recombination.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.