Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.25

Knowledge Summary

Patent

No data available

Expression

 GO Function (1)

 Compartment GO Term (2)

AA Sequence

MPLPEPSEQEGESVKASQEPSPKPGTEVIPAAPRKPRKFSKLVLLTASKDSTKVAGAKRKGVHCVMSLGV      1 - 70
PGPATLAKALLQTHPEAQRAIEAAPQEPEQKRSRQDPGTDRTEDSGLAAGPPEAAGENFAPCSVAPGKSL     71 - 140
//

Text Mined References (7)

PMID Year Title