Property Summary

NCBI Gene PubMed Count 30
PubMed Score 30.63
PubTator Score 123.54

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Gene RIF (13)

PMID Text
26067085 Data shows that FLVCR1a participates in the control of intestinal mucosa homeostasis by exporting the excess of de novo synthesized heme from intestinal cells.
25795718 Flvcr1 regulates differentiation of erythroid progenitors by controlling intracellular heme accumulation.
24576667 both HIF2alpha and ETS1 are involved in the transcriptional regulation of Flvcr1a and that HIF2alpha is absolutely required for Flvcr1a induction upon hypoxia
23187127 FLVCR1b regulates erythropoiesis by controlling mitochondrial heme efflux, whereas FLVCR1a expression is required to prevent hemorrhages and edema.
22483575 FLVCR1 mutants failed to fold properly in the ER, were rapidly degraded in the lysosomes, and therefore, could not export heme out of cells. Thus, accumulation of heme in FLVCR1-mutant cells could cause cellular toxicity.
22279524 Study identified sequence variants in the known disease-causing genes SLC6A3 and FLVCR1, and present evidence to strongly support the pathogenicity of variants identified in TUBGCP6, BRAT1, SNIP1, CRADD, and HARS.
21593354 relative protein expression of 2 heme transporters, Feline Leukemia Virus, Subgroup C, Receptor 1 (FLVCR1) and Breast Cancer Resistance Protein, was assessed in placental tissue in relation to maternal/neonatal iron status and placental iron concentration
21267618 Posterior column ataxia with retinitis pigmentosa is caused by mutations in FLVCR1.
21070897 These results suggest that aberrant FLVCR1 causes a selective degeneration of a subpopulation of neurons in the retina and the posterior columns of the spinal cord via dysregulation of heme or iron homeostasis.
20610401 hemopexin directly interacts with FLVCR
18815190 Alternative splicing of FLVCR1 transcripts and subsequent FLVCR1 insufficiency is an additional contributing factor to the erythropoietic defect observed in Diamond-Blackfan anemia.
16439531 results suggest that multiple FLVCR1 regions are critical for mediating efficient feline leukemia virus subgroup C (FeLV-C) infection and that these regions are distinct from the FeLV-C envelope binding site
15996880 the FLVCR gene on 1q31 is not involved in Diamond-Blackfan anemia in families studied

AA Sequence

MARPDDEEGAAVAPGHPLAKGYLPLPRGAPVGKESVELQNGPKAGTFPVNGAPRDSLAAASGVLGGPQTP      1 - 70
LAPEEETQARLLPAGAGAETPGAESSPLPLTALSPRRFVVLLIFSLYSLVNAFQWIQYSIISNVFEGFYG     71 - 140
VTLLHIDWLSMVYMLAYVPLIFPATWLLDTRGLRLTALLGSGLNCLGAWIKCGSVQQHLFWVTMLGQCLC    141 - 210
SVAQVFILGLPSRIASVWFGPKEVSTACATAVLGNQLGTAVGFLLPPVLVPNTQNDTNLLACNISTMFYG    211 - 280
TSAVATLLFILTAIAFKEKPRYPPSQAQAALQDSPPEEYSYKKSIRNLFKNIPFVLLLITYGIMTGAFYS    281 - 350
VSTLLNQMILTYYEGEEVNAGRIGLTLVVAGMVGSILCGLWLDYTKTYKQTTLIVYILSFIGMVIFTFTL    351 - 420
DLRYIIIVFVTGGVLGFFMTGYLPLGFEFAVEITYPESEGTSSGLLNASAQIFGILFTLAQGKLTSDYGP    421 - 490
KAGNIFLCVWMFIGIILTALIKSDLRRHNINIGITNVDVKAIPADSPTDQEPKTVMLSKQSESAI         491 - 555
//

Text Mined References (36)

PMID Year Title
26067085 2015 Crucial Role of FLVCR1a in the Maintenance of Intestinal Heme Homeostasis.
25795718 2015 The heme exporter Flvcr1 regulates expansion and differentiation of committed erythroid progenitors by controlling intracellular heme accumulation.
24576667 2014 Hypoxia controls Flvcr1 gene expression in Caco2 cells through HIF2? and ETS1.
23187127 2012 The mitochondrial heme exporter FLVCR1b mediates erythroid differentiation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22483575 2012 Mutations of FLVCR1 in posterior column ataxia and retinitis pigmentosa result in the loss of heme export activity.
22279524 2012 Genetic mapping and exome sequencing identify variants associated with five novel diseases.
21593354 2011 Placental expression of the heme transporter, feline leukemia virus subgroup C receptor, is related to maternal iron status in pregnant adolescents.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21267618 2011 Posterior column ataxia with retinitis pigmentosa in a Japanese family with a novel mutation in FLVCR1.
21238504 2011 Control of intracellular heme levels: heme transporters and heme oxygenases.
21070897 2010 Mutations in FLVCR1 cause posterior column ataxia and retinitis pigmentosa.
20610401 2010 Kinetics and specificity of feline leukemia virus subgroup C receptor (FLVCR) export function and its dependence on hemopexin.
20454576 2010 Diamond Blackfan Anemia at the Crossroad between Ribosome Biogenesis and Heme Metabolism.
20222826 2010 An all-feline retroviral packaging system for transduction of human cells.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19416867 2009 The transcriptome of human CD34+ hematopoietic stem-progenitor cells.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19369334 2009 Identification of a feline leukemia virus variant that can use THTR1, FLVCR1, and FLVCR2 for infection.
18815190 2008 Enhanced alternative splicing of the FLVCR1 gene in Diamond Blackfan anemia disrupts FLVCR1 expression and function that are critical for erythropoiesis.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17945326 2008 The C domain in the surface envelope glycoprotein of subgroup C feline leukemia virus is a second receptor-binding domain.
16439531 2006 Comprehensive mapping of receptor-functioning domains in feline leukemia virus subgroup C receptor FLVCR1.
16368877 2006 Genomic annotation of 15,809 ESTs identified from pooled early gestation human eyes.
15996880 Investigation of a putative role for FLVCR, a cytoplasmic heme exporter, in Diamond-Blackfan anemia.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15369674 2004 Identification of a human heme exporter that is essential for erythropoiesis.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11943475 2002 Genomic structure and evolutionary context of the human feline leukemia virus subgroup C receptor (hFLVCR) gene: evidence for block duplications and de novo gene formation within duplicons of the hFLVCR locus.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.
10648427 2000 Cloning of the cellular receptor for feline leukemia virus subgroup C (FeLV-C), a retrovirus that induces red cell aplasia.
10400745 1999 A putative cell surface receptor for anemia-inducing feline leukemia virus subgroup C is a member of a transporter superfamily.
9921862 1999 Posterior column ataxia with retinitis pigmentosa (AXPC1) maps to chromosome 1q31-q32.
9409377 1997 An autosomal recessive disorder with posterior column ataxia and retinitis pigmentosa.