Property Summary

NCBI Gene PubMed Count 202
PubMed Score 499.02
PubTator Score 414.41

Knowledge Summary

Patent (116,835)

Expression

  Differential Expression (4)

Disease log2 FC p
malignant mesothelioma 1.200 8.6e-05
osteosarcoma -2.145 2.1e-05
atypical teratoid / rhabdoid tumor 1.100 1.5e-04
glioblastoma 1.300 2.8e-04

 CSPA Cell Line (1)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (169)

PMID Text
27066737 this study uncovers a unique molecular mechanism of lymphangiogenesis in which galectin-8-dependent crosstalk among VEGF-C, podoplanin and integrin pathways plays a key role.
26735859 Report FLT4 genetic alterations in angiosarcomas.
26714373 Case Reports: novel FLT4 gene mutation in a Chinese family with Milroy disease.
26706909 The most extensively accepted signaling pathways promoting lymphangiogenesis in tumors include the secreted lymphangiogenic proteins: VEGF-C and VEGF-D, and their cognate receptor on lymphatic endothelium VEGF receptor-3 (VEGFR-3).
26543080 MTA1 is up-regulated in CRC; its expression is inversely associated with lymphatic metastases and the expression of VEGFC, VEGFD and VEGFR3
26394830 High expression levels of VEGFR1 and VEGFR3 were associated with a higher rate of lung metastasis.
26121315 VEGFR-3 is a new target to improve net ultrafiltration in methylglyoxal-induced peritoneal injury by suppressing lymphatic absorption
26091406 our findings contribute to the putative targets in which the FLT4 gene mutation was found to have a significant role in lymphatic filariasis, while FOXC2 and FLT4 SNP interactions need to be further elucidated at a functional level.
26091405 A Novel Missense Mutation in FLT4 Causes Autosomal Recessive Hereditary Lymphedema
25909285 Data indicate that foretinib suppresses angiogenesis and lymphangiogenesis by blocking vascular endothelial growth factor receptors
25896638 Missense mutations in VEGFR3 confirmed Milroy disease in two unrelated patients.
25891418 These findings suggest that IL-8 may be a potent inducer of LECs, although this effect does not appear to involve the VEGF-C/VEGF-D and VEGFR-3 signaling pathway.
25864386 Although MYC is a valuable ancillary tool in distinguishing angiosarcomas from atypical vascular lesions , FLT4 immunohistochemistry may be used to screen for patients with FLT4 gene amplification
25667475 High CD31 expression associated significantly with better survival and VEGFR3 had no association with survival. Both higher tumor grade and stage were associated with a decreased survival time
25643397 Experiments in mice and zebrafish demonstrate that changing levels of VEGFR3/Flt4 modulates aortic lumen diameter consistent with flow-dependent remodeling
25605009 Genistein suppresses FLT4 and inhibits human colorectal cancer metastasis.
25543087 Neuropilin-2 mediates lymphangiogenesis of colorectal carcinoma via a VEGFC/VEGFR3 independent signaling.
25524775 VEGFR3 lymphatic endothelium signaling involves regulation of AKT activation via VEGFR3/VEGFR2/neuropilin 1 complex, ERK via VEGFR3/R3 homodimer, as well as regulatory roles of VE-PTP.
25399804 the best characterized of these signaling pathways, that involving the vascular endothelial growth factor (VEGF) family members VEGF-C and VEGF-D, together with their receptors VEGFR2 and VEGFR3.
25340839 VEGFR family members are expressed in leiomyosarcomas in vivo and in vitro. Upon receptor stimulation, PTK787 is able to inhibit subsequent phosphorylation events and influences cell survival but not metabolic activity and migration
25329517 The results show that VEGFR1-VEGFR2 levels are more closely coupled than VEGFR1-VEGFR3 or VEGFR2-VEGFR3 in HUVEC and MEC.
25281926 VEGF-C down-regulates VEGFR-3 in lymphatic endothelial cells
25229256 TNFR1 has a role in mediating TNF-alpha-induced tumour lymphangiogenesis and metastasis by modulating VEGF-C-VEGFR3 signalling
25109169 Case Report: FLT4 missense mutation in Milroy disease.
24982366 The CXCL12-CXCR4 axis may influence the expression of VEGFR3 in urothelial bladder carcinoma and promote tumor recurrence.
24858271 Expression of VEGFR-3 was highly correlated with tumor metastasis in prostate cancer patients.
24845798 The expressions of VEGF-A, VEGFR2 and VEGFR3 were studied in by immunohistochemistry in 76 endometrial carcinoma specimens. VEGFR2 and VEGFR3 receptor expression were also studied by qRT-PCR in 17 tumors in comparison to normal endometrium.
24754736 analysis of how VEGF, VEGFR3, and PDGFRB protein expression is influenced by RAS mutations in medullary thyroid carcinoma
24713547 In primary ovarian cancer tissue, VEGFR3 expression, detected with an frequency of 26%, was mostly located in the vascular wall and across the stroma.
24710631 A novel GC-rich element (GRE) spanning -101/-66 sufficient for VEGFR3 transcription and activated by Sp1 and Sp3, respectively, was identified.
24650367 Data suggest that VEGFC (vascular endothelial growth factor C) enhances cervical cancer invasiveness via up-regulation of galectin-3 via stimulation of NFkappaB/RELA pathway; galectin-3 interacts/activates VEGFR3.
24508126 These findings suggest that the VEGFC/VEGFR3 pathway acts as an enhancer of ovarian cancer progression
24398987 VEGF-C and VEGFR-3 expression was significantly higher in luminal A subtype compared to luminal B.
24341227 The expression of VEGF and its receptors (VEGFR-1, VEGFR-2 and VEGFR-3) was ascertained to be increased in the placental terminal and stem villi, mostly in type 1 diabetes.
24184958 probe F2 facilitated the identification of the target spectrum of the two inhibitors confirming many of the previously identified (off-) targets such as AURKA, FLT4-VEGFR3, IKBKE and PDGFRbeta.
24085575 Increase of VEGFR3 protein expression is associated with oral squamous cell carcinoma.
24040410 increased expression in tumors of Ang-2 may individually, or in combination with VEGFR-3, predict poor prognosis of OSCC
23939705 Transwell assays revealed that VEGF-C receptor, VEGFR-3, as well as chemokine CCL21 receptor, CC chemokine receptor 7 (CCR7), were responsible for the migration of PC3 cells toward hypoxia preconditioned MSCs
23878260 Data indicate that mutation of the conserved residues mediating the D5 interaction (Thr446 and Lys516) and the D7 interaction (Arg737) compromised VEGF-C induced VEGFR-3 activation.
23803010 Data suggest that circulating VEGFR3/CD34 are biomarkers for epithelial ovarian cancer (EOC); circulating bone marrow-derived lymphatic/vascular endothelial progenitor cells are significantly increased in EOC and correlate with lymph node metastasis.
23737988 Expression of VEGF-C, VEGFR-1, and VEGFR-3 in peritumoral liver tissue is associated with a unique type of HCC that has a poorer outcome after hepatectomy
23614535 Lymph node and lung metastases of HEC1A cells were completely suppressed by the muscle-mediated expression of sVEGFR-3.
23591595 unlike an anti-VEGFR-3 Mab (mF4-31C1), DC101 was not capable of eliminating either tumor lymphangiogenesis or lymphogenous metastasis (60 % reduction of lymph node metastasis by DC101 vs 95 % by mF4-31C1).
23580180 study investigated the expression of VEGFR-1, VEGFR-3 and caveolin-1 molecules in 183 colorectal cancer tissue specimens and explored their effect in both clinicopathological parameters and disease prognosis
23552426 Ets-1 is a novel regulator of VEGFR3 and is involved in the induction of angiogenic phenotypes by KSHV.
23490417 The rs10085109 single nucleotide polymorphism in the FLT4 gene were associated with susceptibility to atopic dermatitis.
23404187 this data suggest a relationship between VEGFR-3 and IFN-gamma expression in NK cells.
23336661 Shh, Gli1, VEGFC, and VEGFR3 expression was higher in colorectal adenocarcinoma than in normal mucosa. Gli1 expression correlated with VEGFC and VEGFR3 expression but not lymphatic metastasis.
23074044 Studies indicate that variants in the VEGFR3 (FLT4) gene, encoding vascular endothelial growth factor receptor 3 (VEGFR3), were identified as being responsible for the majority of Milroy disease (MD).
23059888 VEGFR-1, VEGFR-2 and VEGFR-3 are expressed in both fetal and adult bone. The gene expression levels were significantly higher in fetal samples especially in mandibles. In addition, higher levels of VEGFR-3 in orofacial district were confirmed.
23059885 The commitment of Prox1 positive cells through a lymphatic lineage is an early event for cervical neoplastic progression, being present starting with intraepithelial cervical lesions, and is strongly associated with VEGFR3 and VEGF-C expression.
23038639 VEGF-D and VEGFR-3 expression was significantly higher in benign prostate tissue compared to tumor in the stroma and the endothelium of lymphatic and blood vessels.
22965194 The expression of VEGFR-3 and its ligands, VEGF-C and VEGF-D, significantly increased after activating ET(B)R by ET-1 in primary and metastatic melanoma cell lines
22961441 NRP2 and VEGFR-3 mRNA levels were significantly higher in some of the vascular malformations endothelial cells.
22946664 malignant and stromal cells express high levels of VEGFR-3 in all stages of MF.
22910845 The present findings suggest the potential role of VEGF-C in the pathogenesis and development of a pterygium through lymphangiogenesis and the VEGF-C/VEGFR-3 pathway as a novel therapeutic target for the human pterygium.
22844119 K14-VEGFR-3-Ig transgenic mice lack dermal lymphatic capillaries and experience markedly depressed transport of dendritic cells from the skin to draining lymph nodes.
22819208 ELISA for the quantification of sVEGFR-3 in human plasma was validated and applied in clinical trials.
22797697 Data suggest a regulatory role for VEGFR-3 in megakaryopoiesis.
22745786 Vascular endothelial growth factor receptor-3 directly interacts with phosphatidylinositol 3-kinase to regulate lymphangiogenesis.
22542663 results demonstrate that the proteolytic enzyme MMP-9 promotes resistant epithelial breast cancer cells migration and tubular network formation through VEGFR-2/ VEGFR-3 activation
22512651 Binding of VEGF-C and endostatin to recombinant VEGFR-3 is competitive.
22502683 High VEGFR-3 gene expression is associated with lymphatic metastasis in laryngeal squamous cell carcinomas.
22404826 Single nucleotide polymorphisms in VEGFR3 gene is associated with lymphedema after breast cancer.
22366442 VEGFR3 is involved in the induction of lymphangiogenesis which results in lymphatic spread of nasopharyngeal carcinoma.
22326635 A significant relationship was found in salivary gland tumors with myoepithelial differentiation regarding simultaneous positive staining for VEGF-C/VEGF-D and flt-4
22223733 Suggest that miR-1236 may function as a negative regulator of VEGFR-3 signaling during inflammatory lymphangiogenesis.
22179834 Studies indicate that Vascular endothelial growth factor-C (VEGF-C) and VEGF receptor 3 signaling are essential for the development of lymphatic vessels and is a promising target for inhibition of tumor lymphangiogenesis.
22016416 VEGF-A plays a role in the occurrence of OHSS, and the amount of biologically available VEGF-A is modulated by sVEGF-R1, R2 and R3
21972089 Strong expression of VEGF-C and VEGFR-3 in gastrointestinal stromal tumors was not correlated with the clinical parameters of aggressiveness, nor with high lymphatic vessel density.
21912471 LYVE-1, VEGFR-3 and CD44 all play an important role in lymphangiogenesis, invasion and metastasis
21909098 Macrophage-derived VEGF-C activates VEGFR-3 in tip cells to reinforce Notch signalling, which contributes to the phenotypic conversion of endothelial cells at fusion points of vessel sprouts.
21839498 the effects of vegfc/VEGFR3 on the progression of tumor cells to form lymph node metastases occur primarily under an hypoxic tumor microenvironment.
21805024 The recombinant lentivirus particles were able to remarkably suppress VEGFR-3 expression, regulate the cell cycle, inhibit proliferation and induce apoptosis in the MKN45 cell lines.
21751212 Data show that normal thyroid follicular cells express VEGFRs 1, 2, and 3.
21680174 RNAi-mediated silencing of VEGF-C inhibits non-small cell lung cancer progression by simultaneously down-regulating the CXCR4, CCR7, VEGFR-2 and VEGFR-3-dependent axes-induced ERK, p38 and AKT signalling pathways.
21635552 findings show VEGFR-2 and VEGFR-3 expression are markers of a poor prognosis in patients with surgically resected colorectal adenocarcinoma, whereas EGFR has a minor influence
21269982 The correlation between VEGFR-3 and the Gleason score was high in prostate cancer.
21179485 VEGFR-3 is a strong and independent negative prognostic marker for non-GIST STSs with wide resection margins
21163065 VEGFR-3 expression was correlated with histological grade, lymph node status and distant metastasis, but not correlated with gender, age, location, tumor size and TNM staging of papillary renal cell carcinoma.
20949568 High-level MYC amplification was found in 100% of secondary Angiosarcoma (AS), but in none of the AVL or other radiation-associated sarcomas. Coamplification of FLT4 (encoding VEGFR3) was identified in 25% of secondary AS, but not in other types.
20673868 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20606037 The upregulation of VEGFR-3 on tumor blood vessels indicates a potential additional antiangiogenic effect for dual VEGFR-2/VEGFR-3-targeted therapy.
20555004 The herein described case, which is the third reported so far with c.3109G>C mutation, adds data on genotypic-phenotypic correlation of Milroy disease
20452482 Observational study of gene-disease association. (HuGE Navigator)
20431062 Cell adhesion to extracellular matrix induces a downstream signaling using the tyrosine kinase receptor VEGFR-3 as scaffold.
20237496 Observational study of gene-disease association. (HuGE Navigator)
20224550 Both VEGFA and VEGFC potently induce formation of VEGFR2/-3 heterodimers.
20223440 Observational study of gene-disease association. (HuGE Navigator)
20182906 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19940551 Data show that tumor spheroid cells express ABCG2, Bmi1, WNT5A, CD133, prox1 and VEGFR3.
19924384 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19901262 Prox1 synergizes with the p50 of NF-kappaB to control VEGFR-3 expression.
19900702 Stimulation of trophoblasts (BeWo cells) with gal-1 showed a significant alteration of phosphorylation status in 3 receptor tyrosine kinases: JAK2, RET and VEGFR3. Phosphorylation of these kinases could be involved in gal-1-induced cell differentiation.
19813623 There is a close relationship of laryngeal squamous cell carcinomas with the expression of VEGF-C and VEGFR-3.
19787226 High endothelial VEGFR-3 expression in colorectal carcinomas is associated with hematogenous metastasis.
19779139 The VEGF-C/FLT-4 autocrine loop in tumor cells was a potential enhancer system to promote cancer progression.
19706680 Sumoylation of Prox1 controls its ability to induce VEGFR3 expression and lymphatic phenotypes in endothelial cells.
19701853 The nuclear localization of VEGF-C and its receptor Flt-4 is a novel finding from this study. It was more common in follicular than in peripheral T-cell or diffuse large-cell lymphomas. High Flt4 correlated with disseminated disease.
19636022 Phase I dose escalation study of telatinib, a tyrosine kinase inhibitor of vascular endothelial growth factor receptor 2 and 3, platelet-derived growth factor receptor beta, and c-Kit, in patients with advanced or metastatic solid tumors.
19628565 co-expression of PDGF-B and VEGFR-3 is strongly associated with poor survival in NSCLC patients.
19556880 VEGFR-3 overexpression promotes breast cancer cell proliferation, motility, survival, anchorage-independent growth and tumorogenicity in the absence of ligand expression.
19394045 Mutations in the VEGFR3 and FOXC2 genes account for a subset of patients with unexplained in utero generalized subcutaneous edema and hydrops fetalis without family history of lymphedema
19301310 TGFbeta1 stimulates VEGFD/VEGFR3 receptor axis activation leading to increased cell migration and invasion by primary intermediate prostate cancer basal cell cultures
19289394 study showed that hypomorphic VEGFR3 mutations can cause recessive primary congenital lymphoedema
19240177 High VEGFR-3-positive circulating lymphatic/vascular endothelial progenitor cell level is associated with small cell lung cancer.
19151999 VEGFR-3 was detected in 43 of 58 (72%) cavernous lymphangiomas, 20 of 28 (71%) cystic hygromas, six of 12 (50%) lymphangiomas circumscriptum, and seven of ten (70%) intraabdominal lymphangiomas
19099632 As2O3 can inhibit expression of VEGF-C and VEGFR-3 of human gastric cancer xenografts in nude mice.
19068081 High VEGFR-3 in stromal vessels is associated with gastric cancer.
19066962 The expression of VEGF-A, VEGFR-1, VEGFR-2, and VEGFR-3 in was higher in peritumoral liver tissue, while VEGF-C expression was higher in tumor.
19039941 Reduced secretion of VEGF and expression of VEGF-R3 by placental endothelial cells in gestosis can be caused by functional deficiency of the endothelial cells and low viability of endothelial cells.
19002718 prevalence of VEGFR3 mutations in patients with primary lymphoedema
19002718 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18973153 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18829111 VEGFR-1/-3 co-expression is associated with high hemoglobin level in childhood acute lymphoblastic leukemia
18719607 G933R and D1049N mutations in tyrosine kinase domains of FLT4 in Nonne-Milroy lymphadema
18642643 No association was detected between the Single Nucleotide Polymorphism in the Vascular Endothelial Growth Factor and susceptibility to hemifacial spasm.
18594512 results implicate VEGFR-3 as a regulator of vascular network formation
18564920 Observational study of gene-disease association. (HuGE Navigator)
18561194 VEGF-C and VEGF-D expressions were associated with VEGFR-3 expression and were significantly correlated with both peritumoral lymphangiogenesis and lymph node metastasis.
18538739 Provide further evidence that VEGF-C/VEGFR-3 are expressed and function in cancer cells.
18538738 VEGFR-3 expression is restricted to blood and lymphatic vessels in solid tumors.
18440723 Report expression of VEGF-C/VEGFR3 in osteosarcomas.
18307927 The high expressions of VEGF-C/VEGFR-3 and inactivation of nm23-H(1) may play an important role in lymphatic metastasis in oral squamous cell carcinoma.
18292935 Under hypoxic conditions an autocrine loop between VEGF-C/VEGFR-3 and HIF-1 alpha is possible in breast carcinoma and lung carcinoma but not in colorectal carcinoma cell lines.
18279219 The present study identified 2 novel VEGFR3 mutations in Japanese families with Milroy's disease.
18212541 Three of the 4 Retiform hemangioendothelioma (RH) biopsies failed to demonstrate D2-40, none expressed VEGFR-3...RH is a vascular entity which usually does not have lymphatic differentiation, but may rarely express D2-40.
18094729 VEGFR3 single nucleotide polymorphisms andthe haplotype GC in the VEGFA gene are associated with psoriasis in Koreans
18008346 VEGFR-3 was expressed in malignant cells from different subtypes of MM
18006056 Increased expression of VEGFR-3 is associated with acute myeloid leukaemia
17948123 Data demonstrate that Notch1 and VEGFR-3 interact genetically, that Notch directly induces VEGFR-3 in blood endothelial cells to regulate vascular development, and that Notch and VEGF signaling may function in tumor lymphangiogenesis.
17945164 the spectrum of the VEGFR-3 gene mutations causing HL-I
17935478 data suggest that VEGF-C alters lymphatic endothelial function through a mechanism involving VEGFR-3
17926187 Expression of VEGF-C, VEGF-D and their receptor VEGFR-3 in diffuse large B-cell lymphomas.
17761831 interaction of CEACAM1 with Prox1 and VEGFR-3 plays a crucial role in tumor lymphangiogenesis and reprogramming of vascular endothelial cells to lymphatic endothelial cells
17686546 In non-small-cell lung cancer cells, VEGF-C/VEGFR-3 coexpression suggests an autocrine/paracrine loop responsible for a high proliferation rate in tumour cells.
17597103 Both VEGF-A and angiopoietin-2 upregulated the expression of VEGFR-3 in cultured lymphatic endothelial cells
17539024 expression of VEGFR-3(S) is up-regulated in >75% of hepatitis B x antigen positive hepatocellular carcinoma (HCC) nodules; HBxAg may short circuit VEGFR-3(S) signaling in liver cancer
17487423 VEGFR-3 may play a role in the abnormal endometrial angiogenesis of idiopathic menorrhagia.
17458866 This is the first report of an exon 22 mutation of VEGFR3 in Milroy disease.
17088944 These results suggest that the expression of VEGFRs and NRPs on keratinocytes may constitute important regulators for its activity and may possibly be responsible for the autocrine signaling in the epidermis.
16959214 multiple myeloma cells (but not B-cell chronic lymphocytic leukemia cells) induced a dramatic increase in expression of VEGFR-1 and VEGFR-3 on human bone marrow endothelial cells
16755294 The VEGF-3/VEGFR-c ratio was positively associated with lymph node metastasis in non-small cell lung cancer .
16624815 VEGF-D/VEGFR-3 signaling plays a critical role in osteoblast maturation
16525637 VEGFR-3/flt4 was expressed in cancer stromal cells.
16375119 VEGF-C and its receptor FLT-4 play an important role in the lymphatic metastasis of laryngeal and hypopharyngeal squamous cell carcinoma.
16116610 Overexpression of vascular endothelial growth factor receptor 3 is associated with lung adenocarcinoma
16044920 There was a close correlation between the expressions of VEGFR-3, CD31 and prostate tumor metastases.
15880525 increased expression of VEGF-C and VEGFR-3 play a role in prostate cancer progression and in metastasis to regional lymph nodes
15878864 KSHV gB can activate VEGFR-3 on the microvascular endothelium and modulate endothelial cell migration and proliferation via an interaction between the alpha3beta1 integrin and the VEGFR-3 receptor
15746084 Ang1 has a role in lymphatic vessel endothelial proliferation, Tie2 expression, and VEGFR-3 upregulation
15693535 Patients with primary lymphedema have serum level of VEGF-D significantly higher than controls.The increased levels of VEGF-D suggest that primary lymphedema may be based on defective stimulation of VEGFR-3.
15474514 VEGFR-3 needs to be associated to VEGFR-2 to induce ligand-dependent cellular responses
15389531 integrin alpha5beta1 participates in the activation of both VEGFR-3 and its downstream PI3 kinase/Akt signaling pathway, which is essential for fibronectin-mediated lymphatic endothelial cell survival and proliferation.
15297417 vascular endothelial growth factor receptor-3 may have a role in lymph node metastasis in prostate cancer
15107801 expression levels were significantly elevated in primary prostatic tumors with sentinel lymph node involvement compared to those lacking lymph node involvement
15102829 VEGFR-3 may protect against oxidative damage in endothelial cells, and that patients with hereditary lymphoedema may be susceptible to ROS-induced cell damage.
14760756 VEGF-C and its receptor FLT-4 play a role in the development of gastric cancer, and the tumors with expression of VEGF-C and FLT-4 are more likely to have lymph node metastasis.
14687619 Specific VEGFR3 expression, examined in 27 B-CLL samples, was positive in 26 of them. The VEGF transduction pathway may be very active in CLL cells. Both its paracrine & autocrine pathways may contribute to their enhanced survival.
14558949 VEGF-C/flt-4 system can promote vasculogenesis in stroma of breast cancer. The number of Flt-4 positive vessels is closely related to lymph node metastasis.
12881528 the carboxyl-terminal tail of VEGFR-3 provides important regulatory tyrosine phosphorylation sites with potential signal transduction capacity and these sites are differentially used in ligand-induced homo- and heterodimeric receptor complexes
12819011 Data demonstrate the expression of vascular endothelial growth factor receptor-3 and vascular endothelial growth factor-C on corneal dendritic cells, which implicate a potential relationship between lymphangiogenesis and leukocyte trafficking in the eye.
12393704 generation of endothelial cells from CD34+ cells is associated with expression of VEGFR3 on the cell surface
12168824 Vascular endothelial growth factor receptor-3 (VEGFR-3) and its ligand VEGF-C are expressed in human colorectal adenocarcinoma.
12048269 Suppression of tumor lymphangiogenesis and lymph node metastasis by blocking vascular endothelial growth factor receptor 3 signaling.
11877295 VEGF-C signaling through FLT-4 (VEGFR-3) mediates leukemic cell proliferation, survival, and resistance to chemotherapy.
11807987 A potential mechanism involved in hemangioma formation is the alteration of the FLT4 signaling pathway in endothelial and/or pericytic cells.

AA Sequence

MQRGAALCLRLWLCLGLLDGLVSGYSMTPPTLNITEESHVIDTGDSLSISCRGQHPLEWAWPGAQEAPAT      1 - 70
GDKDSEDTGVVRDCEGTDARPYCKVLLLHEVHANDTGSYVCYYKYIKARIEGTTAASSYVFVRDFEQPFI     71 - 140
NKPDTLLVNRKDAMWVPCLVSIPGLNVTLRSQSSVLWPDGQEVVWDDRRGMLVSTPLLHDALYLQCETTW    141 - 210
GDQDFLSNPFLVHITGNELYDIQLLPRKSLELLVGEKLVLNCTVWAEFNSGVTFDWDYPGKQAERGKWVP    211 - 280
ERRSQQTHTELSSILTIHNVSQHDLGSYVCKANNGIQRFRESTEVIVHENPFISVEWLKGPILEATAGDE    281 - 350
LVKLPVKLAAYPPPEFQWYKDGKALSGRHSPHALVLKEVTEASTGTYTLALWNSAAGLRRNISLELVVNV    351 - 420
PPQIHEKEASSPSIYSRHSRQALTCTAYGVPLPLSIQWHWRPWTPCKMFAQRSLRRRQQQDLMPQCRDWR    421 - 490
AVTTQDAVNPIESLDTWTEFVEGKNKTVSKLVIQNANVSAMYKCVVSNKVGQDERLIYFYVTTIPDGFTI    491 - 560
ESKPSEELLEGQPVLLSCQADSYKYEHLRWYRLNLSTLHDAHGNPLLLDCKNVHLFATPLAASLEEVAPG    561 - 630
ARHATLSLSIPRVAPEHEGHYVCEVQDRRSHDKHCHKKYLSVQALEAPRLTQNLTDLLVNVSDSLEMQCL    631 - 700
VAGAHAPSIVWYKDERLLEEKSGVDLADSNQKLSIQRVREEDAGRYLCSVCNAKGCVNSSASVAVEGSED    701 - 770
KGSMEIVILVGTGVIAVFFWVLLLLIFCNMRRPAHADIKTGYLSIIMDPGEVPLEEQCEYLSYDASQWEF    771 - 840
PRERLHLGRVLGYGAFGKVVEASAFGIHKGSSCDTVAVKMLKEGATASEHRALMSELKILIHIGNHLNVV    841 - 910
NLLGACTKPQGPLMVIVEFCKYGNLSNFLRAKRDAFSPCAEKSPEQRGRFRAMVELARLDRRRPGSSDRV    911 - 980
LFARFSKTEGGARRASPDQEAEDLWLSPLTMEDLVCYSFQVARGMEFLASRKCIHRDLAARNILLSESDV    981 - 1050
VKICDFGLARDIYKDPDYVRKGSARLPLKWMAPESIFDKVYTTQSDVWSFGVLLWEIFSLGASPYPGVQI   1051 - 1120
NEEFCQRLRDGTRMRAPELATPAIRRIMLNCWSGDPKARPAFSELVEILGDLLQGRGLQEEEEVCMAPRS   1121 - 1190
SQSSEEGSFSQVSTMALHIAQADAEDSPPSLQRHSLAARYYNWVSFPGCLARGAETRGSSRMKTFEEFPM   1191 - 1260
TPTTYKGSVDNQTDSGMVLASEEFEQIESRHRQESGFSCKGPGQNVAVTRAHPDSQGRRRRPERGARGGQ   1261 - 1330
VFYNSEYGELSEPSEEDHCSPSARVTFFTDNSY                                        1331 - 1363
//

Text Mined References (215)

PMID Year Title
27066737 2016 Pathological lymphangiogenesis is modulated by galectin-8-dependent crosstalk between podoplanin and integrin-associated VEGFR-3.
26735859 2016 Recurrent CIC Gene Abnormalities in Angiosarcomas: A Molecular Study of 120 Cases With Concurrent Investigation of PLCG1, KDR, MYC, and FLT4 Gene Alterations.
26714373 2015 A NOVEL FLT4 GENE MUTATION AND MR LYMPHANGIOGRAPHY IN A CHINESE FAMILY WITH MILROY DISEASE.
26706909 2016 IGFBP7 functions as a potential lymphangiogenesis inducer in non-small cell lung carcinoma.
26543080 MTA1 Is Up-regulated in Colorectal Cancer and Is Inversely Correlated with Lymphatic Metastasis.
26394830 2015 Angiogenesis-related protein expression in bevacizumab-treated metastatic colorectal cancer: NOTCH1 detrimental to overall survival.
26121315 2015 Vascular endothelial growth factor receptor-3 is a novel target to improve net ultrafiltration in methylglyoxal-induced peritoneal injury.
26091406 2015 FOXC2 and FLT4 Gene Variants in Lymphatic Filariasis.
26091405 2015 A Novel Missense Mutation in FLT4 Causes Autosomal Recessive Hereditary Lymphedema.
25909285 2015 Foretinib inhibits angiogenesis, lymphangiogenesis and tumor growth of pancreatic cancer in vivo by decreasing VEGFR-2/3 and TIE-2 signaling.
25896638 Antenatal presentation of hereditary lymphedema type I.
25891418 2015 Interleukin-8: A potent promoter of human lymphatic endothelial cell growth in gastric cancer.
25864386 2015 The utility of MYC and FLT4 in the diagnosis and treatment of postradiation atypical vascular lesion and angiosarcoma of the breast.
25667475 2015 VEGFR3 and CD31 as prognostic factors in renal cell cancer.
25643397 2015 Vascular remodeling is governed by a VEGFR3-dependent fluid shear stress set point.
25605009 2015 Genistein suppresses FLT4 and inhibits human colorectal cancer metastasis.
25543087 2015 Neuropilin-2 mediates lymphangiogenesis of colorectal carcinoma via a VEGFC/VEGFR3 independent signaling.
25524775 2015 Molecular controls of lymphatic VEGFR3 signaling.
25399804 2015 VEGFR signaling during lymphatic vascular development: From progenitor cells to functional vessels.
25340839 2014 The inhibition of tyrosine kinase receptor signalling in leiomyosarcoma cells using the small molecule kinase inhibitor PTK787/ZK222584 (Vatalanib®).
25329517 2014 Angiogenesis interactome and time course microarray data reveal the distinct activation patterns in endothelial cells.
25281926 2014 Involvement of lysosomal degradation in VEGF-C-induced down-regulation of VEGFR-3.
25229256 2014 TNFR1 mediates TNF-?-induced tumour lymphangiogenesis and metastasis by modulating VEGF-C-VEGFR3 signalling.
25109169 2014 A novel FLT4 mutation identified in a patient with Milroy disease.
24982366 2014 Immunohistochemical evaluation of CXCL12-CXCR4 axis and VEGFR3 expression in primary urothelial cancer and its recurrence.
24858271 2014 Associations of nm23H1, VEGF-C, and VEGF-3 receptor in human prostate cancer.
24845798 2014 Expression profiling and significance of VEGF-A, VEGFR2, VEGFR3 and related proteins in endometrial carcinoma.
24754736 2014 VEGF, VEGFR3, and PDGFRB protein expression is influenced by RAS mutations in medullary thyroid carcinoma.
24713547 2014 Explorative investigation of vascular endothelial growth factor receptor expression in primary ovarian cancer and its clinical relevance.
24710631 2014 Transcription of the vascular endothelial growth factor receptor-3 (VEGFR3) gene is regulated by the zinc finger proteins Sp1 and Sp3 and is under epigenetic control: transcription of vascular endothelial growth factor receptor 3.
24650367 2014 Vascular endothelial growth factor C enhances cervical cancer cell invasiveness via upregulation of galectin-3 protein.
24508126 2014 Vascular endothelial growth factor c promotes ovarian carcinoma progression through paracrine and autocrine mechanisms.
24398987 2013 Lymphatic microvessels density, VEGF-C, and VEGFR-3 expression in 25 cases of breast invasive lobular carcinoma.
24341227 [Comparative immunohistochemical evaluation of vascular endothelial growth factor and its receptors in the placental villi in gestational diabetes mellitus and type 1 diabetes].
24184958 2014 A new chemical probe for quantitative proteomic profiling of fibroblast growth factor receptor and its inhibitors.
24085575 2014 High interstitial fluid pressure promotes tumor progression through inducing lymphatic metastasis-related protein expressions in oral squamous cell carcinoma.
24040410 2013 Expression of angiopoietin-2 and vascular endothelial growth factor receptor-3 correlates with lymphangiogenesis and angiogenesis and affects survival of oral squamous cell carcinoma.
23939705 2013 Hypoxia preconditioning of mesenchymal stromal cells enhances PC3 cell lymphatic metastasis accompanied by VEGFR-3/CCR7 activation.
23878260 2013 Structural and mechanistic insights into VEGF receptor 3 ligand binding and activation.
23803010 2013 High levels of circulating CD34+/VEGFR3+ lymphatic/vascular endothelial progenitor cells is correlated with lymph node metastasis in patients with epithelial ovarian cancer.
23737988 2013 Prognostic roles of cross-talk between peritumoral hepatocytes and stromal cells in hepatocellular carcinoma involving peritumoral VEGF-C, VEGFR-1 and VEGFR-3.
23614535 2013 Suppression of lymph node and lung metastases of endometrial cancer by muscle-mediated expression of soluble vascular endothelial growth factor receptor-3.
23591595 2013 Signaling for lymphangiogenesis via VEGFR-3 is required for the early events of metastasis.
23580180 2013 Vascular endothelial growth factor receptors 1,3 and caveolin-1 are implicated in colorectal cancer aggressiveness and prognosis--correlations with epidermal growth factor receptor, CD44v6, focal adhesion kinase, and c-Met.
23552426 2013 Ets-1 is required for the activation of VEGFR3 during latent Kaposi's sarcoma-associated herpesvirus infection of endothelial cells.
23490417 2013 Single nucleotide polymorphism in the FLT4 gene is associated with atopic dermatitis in Koreans.
23404187 2013 A VEGFR-3 antagonist increases IFN-? expression on low functioning NK cells in acute myeloid leukemia.
23382219 2013 Structural basis for endosomal trafficking of diverse transmembrane cargos by PX-FERM proteins.
23336661 2013 Expression of GLI1 correlates with expression of lymphangiogenesis proteins, vascular endothelial growth factor C and vascular endothelial growth factor receptor 3, in colorectal cancer.
23074044 2013 FLT4/VEGFR3 and Milroy disease: novel mutations, a review of published variants and database update.
23059888 2012 Expression and localization of VEGF receptors in human fetal skeletal tissues.
23059885 2012 Prox 1, VEGF-C and VEGFR3 expression during cervical neoplasia progression as evidence of an early lymphangiogenic switch.
23038639 2013 Differential expression of VEGF ligands and receptors in prostate cancer.
22965194 2013 Endothelin-1 induces the transactivation of vascular endothelial growth factor receptor-3 and modulates cell migration and vasculogenic mimicry in melanoma cells.
22961441 2013 Neuropilin-2 and vascular endothelial growth factor receptor-3 are up-regulated in human vascular malformations.
22946664 2013 Vascular endothelial growth factor receptor-3 expression in mycosis fungoides.
22939624 2012 Quantitative analysis of HSP90-client interactions reveals principles of substrate recognition.
22910845 2013 Expression of vascular endothelial growth factor C in human pterygium.
22844119 2012 Impaired humoral immunity and tolerance in K14-VEGFR-3-Ig mice that lack dermal lymphatic drainage.
22819208 2012 Determination of soluble vascular endothelial growth factor receptor 3 (sVEGFR-3) in plasma as pharmacodynamic biomarker.
22797697 2012 VEGFR-3 is expressed on megakaryocyte precursors in the murine bone marrow and plays a regulatory role in megakaryopoiesis.
22745786 2012 Vascular endothelial growth factor receptor-3 directly interacts with phosphatidylinositol 3-kinase to regulate lymphangiogenesis.
22542663 2012 Tubular network formation by adriamycin-resistant MCF-7 breast cancer cells is closely linked to MMP-9 and VEGFR-2/VEGFR-3 over-expressions.
22512651 2012 Characterization of the interaction between endostatin short peptide and VEGF receptor 3.
22502683 2012 Expression of VEGF-C/VEGFR-3 in human laryngeal squamous cell carcinomas and its significance for lymphatic metastasis.
22404826 2012 Possible genetic predisposition to lymphedema after breast cancer.
22366442 2012 Induction of lymphangiogenesis through vascular endothelial growth factor-C/vascular endothelial growth factor receptor 3 axis and its correlation with lymph node metastasis in nasopharyngeal carcinoma.
22326635 2012 The role of the VEGF-C/-D/flt-4 autocrine loop in the pathogenesis of salivary neoplasms.
22223733 2012 Mirtron microRNA-1236 inhibits VEGFR-3 signaling during inflammatory lymphangiogenesis.
22179834 2012 Interaction of tumor cells and lymphatic vessels in cancer progression.
22016416 2012 Ovarian hyperstimulation syndrome is correlated with a reduction of soluble VEGF receptor protein level and a higher amount of VEGF-A.
21972089 2011 Lymphangiogenic VEGF-C and VEGFR-3 expression in genetically characterised gastrointestinal stromal tumours.
21912471 2011 Relationship between LYVE-1, VEGFR-3 and CD44 gene expressions and lymphatic metastasis in gastric cancer.
21909098 2011 VEGFR-3 controls tip to stalk conversion at vessel fusion sites by reinforcing Notch signalling.
21839498 2011 Suppression of vascular endothelial growth factor receptor 3 (VEGFR3) and vascular endothelial growth factor C (VEGFC) inhibits hypoxia-induced lymph node metastases in cervix cancer.
21805024 2011 Effect of lentivirus-mediated shRNA targeting VEGFR-3 on proliferation, apoptosis and invasion of gastric cancer cells.
21751212 2012 Expression of receptors for VEGFs on normal human thyroid follicular cells and their role in follicle formation.
21711246 2011 Signal transduction by vascular endothelial growth factor receptors.
21680174 2011 RNAi-mediated silencing of VEGF-C inhibits non-small cell lung cancer progression by simultaneously down-regulating the CXCR4, CCR7, VEGFR-2 and VEGFR-3-dependent axes-induced ERK, p38 and AKT signalling pathways.
21635552 2011 Prognostic significance of epidermal growth factor receptor and vascular endothelial growth factor receptor in colorectal adenocarcinoma.
21273538 2011 Combined blockade of VEGFR-2 and VEGFR-3 inhibits inflammatory lymphangiogenesis in early and middle stages.
21269982 2011 [Correlation of the expressions of VEGF-C and VEGFR-3 to the pathological grade of prostate cancer].
21196198 2011 Lymphangiogenesis and cancer metastasis.
21179485 2010 Profiling of VEGFs and VEGFRs as prognostic factors in soft tissue sarcoma: VEGFR-3 is an independent predictor of poor prognosis.
21163065 2010 [Expression of VEGFR-2 and VEGFR-3 in papillary renal cell carcinoma and their relationship with prognosis].
21130043 2010 Effective suppression of vascular network formation by combination of antibodies blocking VEGFR ligand binding and receptor dimerization.
20949568 2011 Consistent MYC and FLT4 gene amplification in radiation-induced angiosarcoma but not in other radiation-associated atypical vascular lesions.
20826270 2010 Protein tyrosine phosphatase PTPN14 is a regulator of lymphatic function and choanal development in humans.
20673868 2010 A genetic association study of maternal and fetal candidate genes that predispose to preterm prelabor rupture of membranes (PROM).
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20606037 2010 Vascular endothelial growth factor receptors VEGFR-2 and VEGFR-3 are localized primarily to the vasculature in human primary solid cancers.
20555004 Milroy's primary congenital lymphedema in a male infant and review of the literature.
20452482 2010 Identification of fetal and maternal single nucleotide polymorphisms in candidate genes that predispose to spontaneous preterm labor with intact membranes.
20445537 2010 Ephrin-B2 controls VEGF-induced angiogenesis and lymphangiogenesis.
20431062 2010 Endothelial cell adhesion to the extracellular matrix induces c-Src-dependent VEGFR-3 phosphorylation without the activation of the receptor intrinsic kinase activity.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20224550 2010 VEGF receptor 2/-3 heterodimers detected in situ by proximity ligation on angiogenic sprouts.
20223440 2010 Allelic variations in angiogenic pathway genes are associated with preeclampsia.
20182906 2011 Influence of pharmacogenetic variability on the pharmacokinetics and toxicity of the aurora kinase inhibitor danusertib.
19940551 2009 Isolation and characterization of spheroid cells from human malignant melanoma cell line WM-266-4.
19924384 2011 Pharmacogenetics of telatinib, a VEGFR-2 and VEGFR-3 tyrosine kinase inhibitor, used in patients with solid tumors.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19901262 2010 Inflammation induces lymphangiogenesis through up-regulation of VEGFR-3 mediated by NF-kappaB and Prox1.
19900702 2009 Inhibiton of RET and JAK2 signals and upregulation of VEGFR3 phosphorylation in vitro by galectin-1 in trophoblast tumor cells BeWo.
19813623 2009 [Relationships of human laryngeal squamous cell carcinomas with the expression of VEGF-C and VEGFR-3].
19787226 2009 Endothelial VEGFR-3 expression in colorectal carcinomas is associated with hematogenous metastasis.
19779139 2009 Autocrine loop between vascular endothelial growth factor (VEGF)-C and VEGF receptor-3 positively regulates tumor-associated lymphangiogenesis in oral squamoid cancer cells.
19706680 2009 Sumoylation of Prox1 controls its ability to induce VEGFR3 expression and lymphatic phenotypes in endothelial cells.
19701853 2009 Expression level, tissue distribution pattern, and prognostic impact of vascular endothelial growth factors VEGF and VEGF-C and their receptors Flt-1, KDR, and Flt-4 in different subtypes of non-Hodgkin lymphomas.
19636022 2009 Phase I dose escalation study of telatinib, a tyrosine kinase inhibitor of vascular endothelial growth factor receptor 2 and 3, platelet-derived growth factor receptor beta, and c-Kit, in patients with advanced or metastatic solid tumors.
19628565 2010 Co-expression of PDGF-B and VEGFR-3 strongly correlates with lymph node metastasis and poor survival in non-small-cell lung cancer.
19610651 2009 Small molecule chloropyramine hydrochloride (C4) targets the binding site of focal adhesion kinase and vascular endothelial growth factor receptor 3 and suppresses breast cancer growth in vivo.
19556880 2009 Vascular endothelial growth factor receptor-3 promotes breast cancer cell proliferation, motility and survival in vitro and tumor formation in vivo.
19394045 2009 Sporadic in utero generalized edema caused by mutations in the lymphangiogenic genes VEGFR3 and FOXC2.
19301310 2009 Role of the VEGFR3/VEGFD receptor axis in TGFbeta1 activation of primary prostate cell lines.
19289394 2009 Recessive primary congenital lymphoedema caused by a VEGFR3 mutation.
19240177 2009 High VEGFR-3-positive circulating lymphatic/vascular endothelial progenitor cell level is associated with poor prognosis in human small cell lung cancer.
19230644 2009 VEGFs and receptors involved in angiogenesis versus lymphangiogenesis.
19151999 2009 VEGF-C and VEGFR-3 in a series of lymphangiomas: is superficial lymphangioma a true lymphangioma?
19099632 2008 [Effect of arsenic trioxide on vascular endothelial growth factor-C and its receptor (VEGFR-3) in nude mice with gastric cancer].
19068081 2009 Impact of vascular endothelial growth factor receptor 1, 2, and 3 expression on the outcome of patients with gastric cancer.
19066962 2009 Protein expression profiling of vascular endothelial growth factor and its receptors identifies subclasses of hepatocellular carcinoma and predicts survival.
19039941 2008 Expression of VEGF and VEGF-R3 receptor by placental endothelial cells in health and gestosis.
19002718 2009 Analysis of the coding regions of VEGFR3 and VEGFC in Milroy disease and other primary lymphoedemas.
18973153 2008 A recurrent ITGA9 missense mutation in human fetuses with severe chylothorax: possible correlation with poor response to fetal therapy.
18829111 2009 Secretion of MMP-2 and MMP-9 induced by VEGF autocrine loop correlates with clinical features in childhood acute lymphoblastic leukemia.
18719607 2009 Functional analysis of FLT4 mutations associated with Nonne-Milroy lymphedema.
18680722 2008 VEGF receptor protein-tyrosine kinases: structure and regulation.
18642643 2008 The role of genetic factors in the development of hemifacial spasm: preliminary results.
18594512 2008 Blocking VEGFR-3 suppresses angiogenic sprouting and vascular network formation.
18593464 2008 Novel splice variants derived from the receptor tyrosine kinase superfamily are potential therapeutics for rheumatoid arthritis.
18564920 2008 HGF and MET mutations in primary and secondary lymphedema.
18561194 2008 Lymphangiogenesis and its relationship with lymphatic metastasis and prognosis in malignant melanoma.
18538739 2008 Further evidence for expression and function of the VEGF-C/VEGFR-3 axis in cancer cells.
18538738 2008 VEGFR-3 expression is restricted to blood and lymphatic vessels in solid tumors.
18440723 2008 Expression of vascular endothelial growth factor-C and its receptor in osteosarcomas.
18307927 2007 [Expression of vascular endothelial growth factor, vascular endothelial growth factor receptor-3 and nm23-H1 in oral squamous cell carcinoma].
18292935 2008 Hypoxia-induced epithelial VEGF-C/VEGFR-3 upregulation in carcinoma cell lines.
18279219 2008 Molecular characterization of two novel VEGFR3 mutations in Japanese families with Milroy's disease.
18212541 2008 Retiform hemangioendotheliomas usually do not express D2-40 and VEGFR-3.
18094729 2008 Single-nucleotide polymorphisms and haplotypes in the VEGF receptor 3 gene and the haplotype GC in the VEGFA gene are associated with psoriasis in Koreans.
18008346 2007 Immunohistochemical expression and distribution of VEGFR-3 in malignant mesothelioma.
18006056 2008 Expression of VEGF-C and its receptor VEGFR-3 in the bone marrow of patients with acute myeloid leukaemia.
17948123 2007 Notch alters VEGF responsiveness in human and murine endothelial cells by direct regulation of VEGFR-3 expression.
17945164 2007 Identification of a novel VEGFR-3 missense mutation in a Chinese family with hereditary lymphedema type I.
17935478 2007 VEGF-C alters barrier function of cultured lymphatic endothelial cells through a VEGFR-3-dependent mechanism.
17926187 2007 Expression of VEGF-C, VEGF-D and their receptor VEGFR-3 in diffuse large B-cell lymphomas.
17761831 2007 Lymphatic reprogramming of microvascular endothelial cells by CEA-related cell adhesion molecule-1 via interaction with VEGFR-3 and Prox1.
17722983 2007 Early endocardial morphogenesis requires Scl/Tal1.
17686546 2007 Vascular endothelial growth factor-C and its receptor VEGFR-3 in non-small-cell lung cancer: concurrent expression in cancer cells from primary tumour and metastatic lymph node.
17597103 2007 Anti-VEGF-A therapy reduces lymphatic vessel density and expression of VEGFR-3 in an orthotopic breast tumor model.
17539024 2007 Hepatitis B x antigen up-regulates vascular endothelial growth factor receptor 3 in hepatocarcinogenesis.
17487423 2007 Expression of vascular endothelial growth factor receptor-3 in the endometrium in menorrhagia.
17458866 2007 A novel VEGFR3 mutation causes Milroy disease.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
17210781 2007 Cooperative and redundant roles of VEGFR-2 and VEGFR-3 signaling in adult lymphangiogenesis.
17088944 Immunolocalization and expression of vascular endothelial growth factor receptors (VEGFRs) and neuropilins (NRPs) on keratinocytes in human epidermis.
17044733 2006 Doxycycline reduces plasma VEGF-C/sVEGFR-3 and improves pathology in lymphatic filariasis.
16965327 2006 Hereditary lymphedema type I associated with VEGFR3 mutation: the first de novo case and atypical presentations.
16959214 2006 Malignant hematopoietic cells induce an increased expression of VEGFR-1 and VEGFR-3 on bone marrow endothelial cells via AKT and mTOR signalling pathways.
16924388 2006 Wide clinical spectrum in a family with hereditary lymphedema type I due to a novel missense mutation in VEGFR3.
16755294 2006 The balance of VEGF-C and VEGFR-3 mRNA is a predictor of lymph node metastasis in non-small cell lung cancer.
16624815 2006 Vascular endothelial growth factor-D activates VEGFR-3 expressed in osteoblasts inducing their differentiation.
16530705 2006 The VEGF-C/Flt-4 axis promotes invasion and metastasis of cancer cells.
16525637 2006 Role of lymphangiogenesis and lymphangiogenic factors during pancreatic cancer progression and lymphatic spread.
16452200 2006 Vascular endothelial growth factor receptor-3 and focal adhesion kinase bind and suppress apoptosis in breast cancer cells.
16375119 2005 [The expression and role of VEGF-C and its receptor FLT-4 in laryngeal and hypopharyngeal squamous cell carcinoma metastasis].
16335952 Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.
16116610 2005 Clinical significance of vascular endothelial growth factor-C and vascular endothelial growth factor receptor 3 in patients with T1 lung adenocarcinoma.
16076871 2005 Direct recruitment of CRK and GRB2 to VEGFR-3 induces proliferation, migration, and survival of endothelial cells through the activation of ERK, AKT, and JNK pathways.
16044920 2005 [Correlation between the expression of VEGF-C mRNA, VEGFR-3, CD31 and tumor metastases in Chinese with prostate cancer].
15880525 2005 Expression of vascular endothelial growth factor C (VEGF-C) and VEGF receptor-3 in human prostate cancer is associated with regional lymph node metastasis.
15878864 2005 Kaposi's sarcoma-associated herpesvirus activation of vascular endothelial growth factor receptor 3 alters endothelial function and enhances infection.
15746084 2005 Angiopoietin-1 promotes lymphatic sprouting and hyperplasia.
15693535 2004 Serum level of VEGF-D in patients with primary lymphedema.
15474514 2004 Heterodimerization with vascular endothelial growth factor receptor-2 (VEGFR-2) is necessary for VEGFR-3 activity.
15389531 2005 Extracellular matrix regulates endothelial functions through interaction of VEGFR-3 and integrin alpha5beta1.
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
15297417 2004 Expression of vascular endothelial growth factor receptor-3 by lymphatic endothelial cells is associated with lymph node metastasis in prostate cancer.
15107801 2004 Expression of a flt-4 (VEGFR3) splicing variant in primary human prostate tumors. VEGF D and flt-4t(Delta773-1081) overexpression is diagnostic for sentinel lymph node metastasis.
15102829 2004 Activation of vascular endothelial growth factor receptor-3 and its downstream signaling promote cell survival under oxidative stress.
14760756 2004 Expression and significance of VEGF-C and FLT-4 in gastric cancer.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14687619 2004 All three receptors for vascular endothelial growth factor (VEGF) are expressed on B-chronic lymphocytic leukemia (CLL) cells.
14648657 2003 Expression of vascular endothelial growth factor (VEGF)-C and VEGF-D, and their receptor VEGFR-3, during different stages of cervical carcinogenesis.
14558949 2003 [Roles of VEGF-C and its receptor Flt-4 in proliferation and metastasis of primary breast cancer].
12881528 2003 Ligand-induced vascular endothelial growth factor receptor-3 (VEGFR-3) heterodimerization with VEGFR-2 in primary lymphatic endothelial cells regulates tyrosine phosphorylation sites.
12819011 2003 Novel expression of vascular endothelial growth factor receptor (VEGFR)-3 and VEGF-C on corneal dendritic cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12393704 2003 VEGFR-3 and CD133 identify a population of CD34+ lymphatic/vascular endothelial precursor cells.
12168824 Expression of the vascular endothelial growth factor receptor-3 (VEGFR-3) and its ligand VEGF-C in human colorectal adenocarcinoma.
12088335 2002 Expression of the vascular endothelial growth factor (VEGF) family in human endometrial blood vessels.
11877295 2002 Vascular endothelial growth factor (VEGF)-C signaling through FLT-4 (VEGFR-3) mediates leukemic cell proliferation, survival, and resistance to chemotherapy.
11807987 2002 Somatic mutation of vascular endothelial growth factor receptors in juvenile hemangioma.
11574540 2001 Multiple forms of mouse vascular endothelial growth factor-D are generated by RNA splicing and proteolysis.
11553610 2001 Stimulation of beta 1 integrin induces tyrosine phosphorylation of vascular endothelial growth factor receptor-3 and modulates cell migration.
11532940 2001 Isolated lymphatic endothelial cells transduce growth, survival and migratory signals via the VEGF-C/D receptor VEGFR-3.
10856194 2000 Congenital hereditary lymphedema caused by a mutation that inactivates VEGFR3 tyrosine kinase.
10835628 2000 Missense mutations interfere with VEGFR-3 signalling in primary lymphoedema.
10579917 1999 Signaling via vascular endothelial growth factor receptors.
9927207 1999 Role of tyrosine residues and protein interaction domains of SHC adaptor in VEGF receptor 3 signaling.
9817924 1998 Hereditary lymphedema: evidence for linkage and genetic heterogeneity.
9435229 1998 Vascular endothelial growth factor D (VEGF-D) is a ligand for the tyrosine kinases VEGF receptor 2 (Flk1) and VEGF receptor 3 (Flt4).
9012504 1996 VEGF-C receptor binding and pattern of expression with VEGFR-3 suggests a role in lymphatic vascular development.
8700872 1996 Vascular endothelial growth factor-related protein: a ligand and specific activator of the tyrosine kinase receptor Flt4.
8662748 1996 Interaction with the phosphotyrosine binding domain/phosphotyrosine interacting domain of SHC is required for the transforming activity of the FLT4/VEGFR3 receptor tyrosine kinase.
8386825 1993 The FLT4 gene encodes a transmembrane tyrosine kinase related to the vascular endothelial growth factor receptor.
7970715 1994 Signalling properties of FLT4, a proteolytically processed receptor tyrosine kinase related to two VEGF receptors.
7898938 1995 Biochemical characterization of two isoforms of FLT4, a VEGF receptor-related tyrosine kinase.
7692369 1993 Two human FLT4 receptor tyrosine kinase isoforms with distinct carboxy terminal tails are produced by alternative processing of primary transcripts.
7675451 1995 Mutation at tyrosine residue 1337 abrogates ligand-dependent transforming capacity of the FLT4 receptor.
1327515 1992 FLT4 receptor tyrosine kinase contains seven immunoglobulin-like loops and is expressed in multiple human tissues and cell lines.
1319394 1992 Chromosomal localization of FLT4, a novel receptor-type tyrosine kinase gene.
1310071 1992 FLT4, a novel class III receptor tyrosine kinase in chromosome 5q33-qter.