Property Summary

NCBI Gene PubMed Count 24
PubMed Score 10.86
PubTator Score 5.93

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
malignant mesothelioma -4.100 1.3e-09
astrocytoma -1.500 3.3e-11
ependymoma -3.000 1.1e-02
oligodendroglioma -2.100 1.3e-02
glioblastoma -2.500 2.8e-03
osteosarcoma -1.835 2.2e-02
cystic fibrosis 1.190 3.7e-04
hereditary spastic paraplegia -1.009 4.9e-02
juvenile dermatomyositis 1.048 1.4e-06
tuberculosis -1.100 1.4e-03
intraductal papillary-mucinous adenoma (... -5.000 3.4e-06
intraductal papillary-mucinous carcinoma... -5.900 2.6e-07
intraductal papillary-mucinous neoplasm ... -6.000 9.7e-07
colon cancer -1.700 2.6e-04
pancreatic cancer -1.400 2.9e-03
pediatric high grade glioma -1.800 6.8e-03
group 4 medulloblastoma -2.600 1.2e-03
breast carcinoma -1.500 1.8e-24
Pick disease 1.900 1.6e-05
Breast cancer -1.800 3.6e-11
invasive ductal carcinoma -2.800 2.1e-04
ulcerative colitis 1.200 7.1e-03
ovarian cancer -6.300 7.6e-18

Protein-protein Interaction (2)

Gene RIF (3)

PMID Text
24732660 PCMC expression of ADAM29, FLRT2, and SLC18A3 could be assessed as part of a routine screen to help identify individuals at risk of severe Obstructive sleep apnea in Asian populations
22747982 The membrane protein, FLRT2, was identified as a novel autoantigen in systemic lupus erythematosus patients.
19834535 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MGLQTTKWPSHGAFFLKSWLIISLGLYSQVSKLLACPSVCRCDRNFVYCNERSLTSVPLGIPEGVTVLYL      1 - 70
HNNQINNAGFPAELHNVQSVHTVYLYGNQLDEFPMNLPKNVRVLHLQENNIQTISRAALAQLLKLEELHL     71 - 140
DDNSISTVGVEDGAFREAISLKLLFLSKNHLSSVPVGLPVDLQELRVDENRIAVISDMAFQNLTSLERLI    141 - 210
VDGNLLTNKGIAEGTFSHLTKLKEFSIVRNSLSHPPPDLPGTHLIRLYLQDNQINHIPLTAFSNLRKLER    211 - 280
LDISNNQLRMLTQGVFDNLSNLKQLTARNNPWFCDCSIKWVTEWLKYIPSSLNVRGFMCQGPEQVRGMAV    281 - 350
RELNMNLLSCPTTTPGLPLFTPAPSTASPTTQPPTLSIPNPSRSYTPPTPTTSKLPTIPDWDGRERVTPP    351 - 420
ISERIQLSIHFVNDTSIQVSWLSLFTVMAYKLTWVKMGHSLVGGIVQERIVSGEKQHLSLVNLEPRSTYR    421 - 490
ICLVPLDAFNYRAVEDTICSEATTHASYLNNGSNTASSHEQTTSHSMGSPFLLAGLIGGAVIFVLVVLLS    491 - 560
VFCWHMHKKGRYTSQKWKYNRGRRKDDYCEAGTKKDNSILEMTETSFQIVSLNNDQLLKGDFRLQPIYTP    561 - 630
NGGINYTDCHIPNNMRYCNSSVPDLEHCHT                                            631 - 660
//

Text Mined References (25)

PMID Year Title
27091502 2016 Super-complexes of adhesion GPCRs and neural guidance receptors.
26890304 2016 Methylation profiling identified novel differentially methylated markers including OPCML and FLRT2 in prostate cancer.
26633812 2015 An extracellular biochemical screen reveals that FLRTs and Unc5s mediate neuronal subtype recognition in the retina.
25728924 2015 Structural basis of latrophilin-FLRT interaction.
24732660 Gene expression profiles in peripheral blood mononuclear cells of Asian obstructive sleep apnea patients.
23720494 2013 Genome-wide association study identifies loci affecting blood copper, selenium and zinc.
23599027 2013 Genome-wide association study of age at menarche in African-American women.
23583979 2013 Identification of heart rate-associated loci and their effects on cardiac conduction and rhythm disorders.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22747982 2012 A novel autoantibody against fibronectin leucine-rich transmembrane protein 2 expressed on the endothelial cell surface identified by retroviral vector system in systemic lupus erythematosus.
22424883 2012 Genome-wide association study of lung function decline in adults with and without asthma.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
19834535 2009 Sequential use of transcriptional profiling, expression quantitative trait mapping, and gene association implicates MMP20 in human kidney aging.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
16872596 2006 Regulated expression of FLRT genes implies a functional role in the regulation of FGF signalling during mouse development.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10644439 1999 Identification of FLRT1, FLRT2, and FLRT3: a novel family of transmembrane leucine-rich repeat proteins.
9455477 1997 Prediction of the coding sequences of unidentified human genes. VIII. 78 new cDNA clones from brain which code for large proteins in vitro.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.