Property Summary

NCBI Gene PubMed Count 90
PubMed Score 121.05
PubTator Score 105.97

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8491 2.1e-06
medulloblastoma, large-cell 6234 6.7e-05

Expression

  Differential Expression (2)

Disease log2 FC p
medulloblastoma, large-cell -1.200 6.7e-05
ovarian cancer 1.800 2.1e-06

Gene RIF (55)

PMID Text
26682635 Flotillin-1 protein is upregulated in human endometrial cancer and localization shifts from epithelial to stromal with increasing tumor grade
26646322 Upregulation of flotillin-1 promotes invasion and metastasis by activating TGF-beta signaling in nasopharyngeal carcinoma.
26413934 Expression of flotillin-1 was associated with H-Ras in breast cancer, especially in TNBC (p < 0.001).
25948494 findings revealed the expression of flotillin 1 in gastric cancer samples is significantly higher than that of noncancer/normal tissues; findings suggest that flotillin 1 may be a novel biomarker for gastric cancer
25793370 miR-506 expression was down-regulated in clear cell renal cell carcinoma (ccRCC) and correlated with advanced histologic grade, clinical stage, tumor stage, positive lymph node metastasis, and distant metastasis. FLOT1, a potential target gene of miR-506, was inversely correlated with miR-506 expression in ccRCC tissues.
25180832 polycystins are necessary for assembly of a novel flotillin-containing ciliary signaling complex and provide a molecular rationale for the common renal pathologies caused by OFD1 and polycystin mutations.
24983503 a critical role of flotillin-1 in ROS production mediated by c-Src
24890092 Findings suggest that FLOT1 plays an important role in the proliferation and recurrence of transitional cell carcinoma.
24886554 Downregulation of microRNA-182-5p contributes to renal cell carcinoma proliferation via activating the AKT/FOXO3a signaling pathway with FLOT1 being a target.
24830726 Flotillin-1 regulates oncogenic signaling in neuroblastoma cells by regulating ALK membrane association.
24747692 Depletion of either flotillin-1 or flotillin-2 resulted in downregulation of ErbB3 and a selective reduction of ErbB2-ErbB3 receptor complexes.
24695539 overexpression of FLOT1 can be found in tongue squamous cell cancer patients with higher pathological stage, T classification, N classification or recurrence
24533441 Flotillin-1 mRNA expression is up-regulated in non-small cell lung cancer patients.
24330780 study demonstrated that miR-124 might be a tumor suppressor in breast cancer via the regulation of FLOT1
24312169 HIV-1 Tat co-localizes with APP and promotes localization of APP to lipid rafts with flotillin-1 in HIV-1 infected U-87 MG cells
24304721 EGFR overexpression and increase in signaling correlates with flotillin-1 expresion.
24277378 Patients with higher FLOT1 expression had shorter overall survival time, whereas those with lower FLOT1 expression had longer survival time
24046456 We have identified flotillin 1 and 2 as new partners of the cadherin complexes
24042857 Human group V secretory phospholipase A2 is associated with lipid rafts and internalized in a flotillindependent pathway.
23861967 HIV-1 Tat co-localizes with APP and promotes localization of APP to lipid rafts with flotillin-1 in HIV-1 infected U-87 MG cells
23627023 Flotillin-1 interacted with PrPc and promote the endocytosis of PrPc.
23625312 These data here provide direct evidences for the molecular interaction and endocytosis of PrP(C) with Flot-1 in the presence of copper ions.
23581411 Flotillin-1 plays an important role in Oral squamous cell carcinoma (OSCC) development.
23064789 The FLOT1 is abundantly expressed in term villous placental CTs and endothelial cells, and in comparison, expression of these proteins in the ST is reduced.
23012365 results support predominant formation of flotillin-1 and -2 hetero-oligomers in resting and chemokine-stimulated human T-cells which may importantly contribute to structuring of the uropod.
22869152 we describe how flotillin-1 and -2 contribute to the stabilization of ErbB2 at the cell surface in breast cancer tissue
22669515 Report role for flotillin 1/2 in interactions of lung epithelial cells with silica nanoparticles.
22235335 a novel signaling network containing FRS2, CAP and flotillin-1
22232557 receptor-tyrosine kinases may also rely on flotillin-1 upon activation, thus suggesting a general role for flotillin-1 as a novel factor in receptor-tyrosine kinase/MAP kinase signaling.
22215737 Chlamydia pneumoniae intracellular growth was attenuated in the flotillin-1-silenced cells.
22190034 HIV-1 Tat co-localizes with APP and promotes localization of APP to lipid rafts with flotillin-1 in HIV-1 infected U-87 MG cells
21447726 FLOT1 plays an important role in promoting proliferation and tumorigenesis of human breast cancer and may represent a novel prognostic biomarker and therapeutic target for the disease.
21399631 Flot1-enriched membrane microdomains are required for protein kinase C-regulated internalization of the DA transporter (DAT) and the glial glutamate transporter EAAT2.
21187433 flotillins have a role in NPC1L1-mediated cholesterol uptake and NPC1L1-flotillins-postive cholesterol-enriched membrane microdomains are involved in the mechanism for efficient cholesterol absorption
20880565 HIV-1 Tat co-localizes with APP and promotes localization of APP to lipid rafts with flotillin-1 in HIV-1 infected U-87 MG cells
20027317 In hematopoietic cells, flotillins provide intrinsic cues that govern segregation of certain microdomain-associated molecules during immune cell polarization.
19851445 Observational study of gene-disease association. (HuGE Navigator)
19815536 Data show that the BCG phagosome is relatively depleted in LAMP-2, NPC1, flotillin-1, vATPase, and syntaxin 3.
19404397 Flotillin-1 and -2 associate with PSGL-1 in resting and in stimulated neutrophils are importantly involved in neutrophil uropod formation and/or stabilization
19348413 the cellular pathways used by transportan and transportan 10 (TP10) for protein transduction
19318123 The hetero-oligomerization with flotillin 1 is necessary for the translocation of flotillin 2, which does not take place in the absence of flotillin 1.
19258392 Endocytosis of flotillins is regulated by the Src family kinase Fyn.
19121286 These data suggest that flotillin-1 regulates caveolin-1 level by preventing its lysosomal degradation in intestinal epithelial cells.
18660489 Observational study of gene-disease association. (HuGE Navigator)
17600709 Coassembly of flotillin1 and flotillin2 into microdomains induces membrane curvature, the formation of plasma-membrane invaginations morphologically similar to caveolae, and the accumulation of intracellular vesicles.
17587329 Flotillin-1 accumulation at the pathogen Mycobacterium marinum replication niche and its rupture were also observed in human peripheral blood monocytes.
17307333 These lines of evidence suggested that a Gq-coupled receptor activates specifically p38 MAPK through lipid rafts and Src kinase activation, in which flotillins positively modulate the Gq signaling.
17113085 The results showed that flotillin-1 can interact with arginase1, and hence arginase activity was up-regulated by 26.8%.
16480949 flotillin-1 may recruit amyloid beta (A4) precursor protein to lipid rafts and therefore participate in the localization and processing of APP
16341206 Flotillin-1 small interfering RNA (siRNA) inhibited both clathrin-independent uptake of cholera toxin and endocytosis of a GPI-linked protein. We propose that flotillin-1 is one determinant of a clathrin-independent endocytic pathway in mammalian cells.
16198165 Myocilins with mutations such as G364V, K423E, and Y437H on the domain failed to interact with flotillin-1.
15939299 Recombinant flotillin-1 was purified and characterized in in large quantity and high purity.
15545008 It is significant that there is an increased gene expression of flotillin-1 in the Parkinson substantia nigra/ventral tegmental area compared to controls.
15469992 ATP-binding cassette, sub-family A (ABC1), member 1 forms a complex with syntaxin 13 and flotillin-1, residing at the plasma membrane and in phagosomes
14708344 Flotillin-1, a marker of rafts, accumulates in lysosomes of neurons in Alzheimer's disease

AA Sequence

MFFTCGPNEAMVVSGFCRSPPVMVAGGRVFVLPCIQQIQRISLNTLTLNVKSEKVYTRHGVPISVTGIAQ      1 - 70
VKIQGQNKEMLAAACQMFLGKTEAEIAHIALETLEGHQRAIMAHMTVEEIYKDRQKFSEQVFKVASSDLV     71 - 140
NMGISVVSYTLKDIHDDQDYLHSLGKARTAQVQKDARIGEAEAKRDAGIREAKAKQEKVSAQYLSEIEMA    141 - 210
KAQRDYELKKAAYDIEVNTRRAQADLAYQLQVAKTKQQIEEQRVQVQVVERAQQVAVQEQEIARREKELE    211 - 280
ARVRKPAEAERYKLERLAEAEKSQLIMQAEAEAASVRMRGEAEAFAIGARARAEAEQMAKKAEAFQLYQE    281 - 350
AAQLDMLLEKLPQVAEEISGPLTSANKITLVSSGSGTMGAAKVTGEVLDILTRLPESVERLTGVSISQVN    351 - 420
HKPLRTA                                                                   421 - 427
//

Text Mined References (99)

PMID Year Title
26682635 2016 Flotillin-1 protein is upregulated in human endometrial cancer and localization shifts from epithelial to stromal with increasing tumor grade.
26646322 2016 Upregulation of flotillin-1 promotes invasion and metastasis by activating TGF-? signaling in nasopharyngeal carcinoma.
26413934 2016 A novel role for flotillin-1 in H-Ras-regulated breast cancer aggressiveness.
25948494 2015 Plasma membrane proteomic analysis of human Gastric Cancer tissues: revealing flotillin 1 as a marker for Gastric Cancer.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25893292 2016 Syntenin regulates TGF-?1-induced Smad activation and the epithelial-to-mesenchymal transition by inhibiting caveolin-mediated TGF-? type I receptor internalization.
25793370 2015 MiR-506 is down-regulated in clear cell renal cell carcinoma and inhibits cell growth and metastasis via targeting FLOT1.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25204797 2014 Flotillin-1 facilitates toll-like receptor 3 signaling in human endothelial cells.
25180832 2014 OFD1 and flotillins are integral components of a ciliary signaling protein complex organized by polycystins in renal epithelia and odontoblasts.
24983503 2014 Phosphorylation of flotillin-1 by mitochondrial c-Src is required to prevent the production of reactive oxygen species.
24890092 2014 Overexpression of flotillin-1 is involved in proliferation and recurrence of bladder transitional cell carcinoma.
24886554 2014 Downregulation of microRNA-182-5p contributes to renal cell carcinoma proliferation via activating the AKT/FOXO3a signaling pathway.
24830726 2014 Flotillin-1 regulates oncogenic signaling in neuroblastoma cells by regulating ALK membrane association.
24809731 2014 Role of dynamin and clathrin in the cellular trafficking of flotillins.
24747692 2014 Flotillin depletion affects ErbB protein levels in different human breast cancer cells.
24695539 2014 Prognostic significance of Flotillin1 expression in clinically N0 tongue squamous cell cancer.
24612608 2014 Flotillins bind to the dileucine sorting motif of ?-site amyloid precursor protein-cleaving enzyme 1 and influence its endosomal sorting.
24533441 2014 Simultaneous expression of flotillin-1, flotillin-2, stomatin and caveolin-1 in non-small cell lung cancer and soft tissue sarcomas.
24330780 2013 Microrna-124 targets flotillin-1 to regulate proliferation and migration in breast cancer.
24304721 2013 Phosphatidylinositol 3-Kinase dependent upregulation of the epidermal growth factor receptor upon Flotillin-1 depletion in breast cancer cells.
24277378 2014 Abnormal expression of FLOT1 correlates with tumor progression and poor survival in patients with non-small cell lung cancer.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24167781 2013 Analysis of close associations of uropod-associated proteins in human T-cells using the proximity ligation assay.
24046456 2013 Flotillin microdomains stabilize cadherins at cell-cell junctions.
24042857 2013 Human group V secretory phospholipase A2 is associated with lipid rafts and internalized in a flotillin?dependent pathway.
23983584 2013 Flotillin-2 expression in the human gut: from a cell model to human tissue in health and inflammatory bowel diseases.
23627023 2012 [Study on the correlation between membrane protein Flotillin-1 and PrPc endocytosis].
23625312 2013 Flotillin-1 mediates PrPc endocytosis in the cultured cells during Cu²? stimulation through molecular interaction.
23581411 2013 Flotillin-1 promotes cell growth and metastasis in oral squamous cell carcinoma.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23064789 2013 Expression of flotillins in the human placenta: potential implications for placental transcytosis.
23012365 2012 Evidence for chemokine-mediated coalescence of preformed flotillin hetero-oligomers in human T-cells.
22869152 2013 Flotillins as regulators of ErbB2 levels in breast cancer.
22669515 2013 Interactions of silica nanoparticles with lung epithelial cells and the association to flotillins.
22235335 2012 Molecular networks in FGF signaling: flotillin-1 and cbl-associated protein compete for the binding to fibroblast growth factor receptor substrate 2.
22232557 2012 Flotillin-1/reggie-2 protein plays dual role in activation of receptor-tyrosine kinase/mitogen-activated protein kinase signaling.
22215737 2012 Flotillin-1 (Reggie-2) contributes to Chlamydia pneumoniae growth and is associated with bacterial inclusion.
21696602 2011 Dynamic reorganization of flotillins in chemokine-stimulated human T-lymphocytes.
21447726 2011 Knockdown of FLOT1 impairs cell proliferation and tumorigenicity in breast cancer through upregulation of FOXO3a.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
21399631 2011 Flotillin-1 is essential for PKC-triggered endocytosis and membrane microdomain localization of DAT.
21269460 2011 Initial characterization of the human central proteome.
21187433 2011 Flotillins play an essential role in Niemann-Pick C1-like 1-mediated cholesterol uptake.
21119006 2011 The kinesin KIF9 and reggie/flotillin proteins regulate matrix degradation by macrophage podosomes.
20848476 2010 Genetic predictors of medically refractory ulcerative colitis.
20682791 2010 A protein interaction network for Ecm29 links the 26 S proteasome to molecular motors and endosomal components.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20027317 2009 Flotillins are involved in the polarization of primitive and mature hematopoietic cells.
19946888 2010 Defining the membrane proteome of NK cells.
19851445 2009 High-density SNP screening of the major histocompatibility complex in systemic lupus erythematosus demonstrates strong evidence for independent susceptibility regions.
19815536 2010 The Mycobacterium bovis bacille Calmette-Guerin phagosome proteome.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19404397 2009 Flotillins interact with PSGL-1 in neutrophils and, upon stimulation, rapidly organize into membrane domains subsequently accumulating in the uropod.
19348413 2009 Protein delivery with transportans is mediated by caveolae rather than flotillin-dependent pathways.
19318123 2009 Hetero-oligomerization of reggie-1/flotillin-2 and reggie-2/flotillin-1 is required for their endocytosis.
19258392 2009 Endocytosis of flotillin-1 and flotillin-2 is regulated by Fyn kinase.
19121286 2009 Flotillin-1 stabilizes caveolin-1 in intestinal epithelial cells.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18850735 2008 Characterization of the human COP9 signalosome complex using affinity purification and mass spectrometry.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18660489 2008 Multiple genetic variants along candidate pathways influence plasma high-density lipoprotein cholesterol concentrations.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
18000879 2008 Novel interaction partners of Bardet-Biedl syndrome proteins.
17897319 2007 Integral and associated lysosomal membrane proteins.
17600709 2007 Coassembly of flotillins induces formation of membrane microdomains, membrane curvature, and vesicle budding.
17587329 2007 Flotillin and RacH modulate the intracellular immunity of Dictyostelium to Mycobacterium marinum infection.
17307333 2007 The lipid raft proteins flotillins/reggies interact with Galphaq and are involved in Gq-mediated p38 mitogen-activated protein kinase activation through tyrosine kinase.
17113085 2006 Arginase-flotillin interaction brings arginase to red blood cell membrane.
17081065 2006 Proteomic and bioinformatic characterization of the biogenesis and function of melanosomes.
16480949 2006 The intracellular domain of amyloid precursor protein interacts with flotillin-1, a lipid raft protein.
16341206 2006 Flotillin-1 defines a clathrin-independent endocytic pathway in mammalian cells.
16198165 2005 Identification of flotillin-1 as a protein interacting with myocilin: implications for the pathogenesis of primary open-angle glaucoma.
15939299 2005 Expression, purification, and characterization of recombinant human flotillin-1 in Escherichia coli.
15862967 2005 Yeast two-hybrid identification of prostatic proteins interacting with human sex hormone-binding globulin.
15713644 2005 PTOV1 enables the nuclear translocation and mitogenic activity of flotillin-1, a major protein of lipid rafts.
15569306 2004 D1 dopamine receptor signaling involves caveolin-2 in HEK-293 cells.
15545008 2004 Flotillin-1 in the substantia nigra of the Parkinson brain and a predominant localization in catecholaminergic nerves in the rat brain.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15469992 2004 Association of ABCA1 with syntaxin 13 and flotillin-1 and enhanced phagocytosis in tangier cells.
15128873 2004 Recruitment of Pyk2 and Cbl to lipid rafts mediates signals important for actin reorganization in growing neurites.
14708344 2003 [Lipid rafts, flotillin-1 and Alzheimer disease].
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11598189 2001 Glycosylphosphatidyl inositol-anchored proteins and fyn kinase assemble in noncaveolar plasma membrane microdomains defined by reggie-1 and -2.
11481476 2001 The sorbin homology domain: a motif for the targeting of proteins to lipid rafts.
11167132 2001 Flotillin-1: gene structure: cDNA cloning from human lung and the identification of alternative polyadenylation signals.
11159550 2001 Stomatin, flotillin-1, and flotillin-2 are major integral proteins of erythrocyte lipid rafts.
11042152 2000 Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells.
11001060 2000 CAP defines a second signalling pathway required for insulin-stimulated glucose transport.
10931946 2000 Gene expression profiling in the human hypothalamus-pituitary-adrenal axis and full-length cDNA cloning.
10462713 1999 Flotillin 2 is distinct from epidermal surface antigen (ESA) and is associated with filopodia formation.
10212252 1999 Flotillins/cavatellins are differentially expressed in cells and tissues and form a hetero-oligomeric complex with caveolins in vivo. Characterization and epitope-mapping of a novel flotillin-1 monoclonal antibody probe.
9153235 1997 Flotillin and epidermal surface antigen define a new family of caveolae-associated integral membrane proteins.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.